KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1867Help
Entry
NMB1867           CDS       T00027                                 

Gene name
dxs
Definition
(RefSeq) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00730  Thiamine metabolism
nme00900  Terpenoid backbone biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    NMB1867 (dxs)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMB1867 (dxs)
Enzymes [BR:nme01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     NMB1867 (dxs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C E1_dh TPP_enzyme_C Transketolase_N
Motif
Other DBs
NCBI-GeneID: 904321
NCBI-ProteinID: NP_274863
UniProt: Q9JXV7
Position
complement(1971047..1972960)
Genome map
AA seq 637 aa AA seqDB search
MNPSPLLDLIDSPQDLRRLDKKQLPRLAGELRTFLLESVGQTGGHFASNLGAVELTIALH
YVYDTPEDKLVWDVGHQSYPHKILTGRKNQMHTMRQYGGLAGFPKRCESEYDAFGVGHSS
TSIGAALGMAAADKLLGSDRRSVAIIGDGAMTAGQAFEALNCAGDMDVDLLVVLNDNEMS
ISPNVGALPKYLASNVVRDMHGLLSTVKAQTGKVLDKIPGAMEFAQKVEHKIKTLAEEAE
HAKQSLSLFENFGFRYTGPVDGHNVENLVDVLKDLRSRKGPQLLHVITKKGNGYKLAEND
PVKYHAVANLPKESAAQMPSEKEPKPAAKPTYTQVFGKWLCDRAAADSRLVAITPAMREG
SGLVEFEQRFPDRYFDVGIAEQHAVTFAGGLACEGMKPVVAIYSTFLQRAYDQLVHDIAL
QNLPVLFAVDRAGIVGADGPTHAGLYDLSFLRCVPNMIVAAPSDENECRLLLSTCYQADA
PAAVRYPRGTGTGAPVSDGMETVEIGKGIIRREGEKTAFIAFGSMVAPALAVAEKLNATV
ADMRFVKPIDEELIVRLARSHDRIVTLEENAEQGGAGGAVLEVLAKHGICKPVLLLGVAD
TVTGHGDPKKLLDDLGLSAEAVERRVRAWLSDRDAAN
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaagccccctactcgacctgattgacagcccgcaagatttgcgccgtctggac
aaaaaacagctgccgcgccttgccggcgagttgcgcacctttctgctggaatctgtcggg
cagaccggcgggcatttcgccagcaatttgggcgcggtcgaactgaccatcgccctgcac
tatgtgtacgacacgcccgaagacaagctggtgtgggatgtcggacaccaaagctatccg
cacaaaatcctgacaggcaggaaaaaccagatgcacaccatgcgccaatatggcggtttg
gcgggttttccgaaacgttgcgagtccgagtacgacgcgttcggcgtggggcattcctcc
acctccatcggcgcggcgttgggcatggcggcggcagacaaactcttgggcagcgaccgc
cgcagcgtcgccatcatcggcgacggcgcgatgacggcggggcaggcgtttgaagccttg
aattgcgcaggcgatatggatgtggatttgctggtcgtcctcaacgacaacgaaatgtcg
atttcccccaacgtcggcgcgctgccgaaataccttgccagcaacgtcgtgcgcgatatg
cacggcctgttgagtaccgtcaaagcgcaaacgggcaaggtattagacaaaatacccggc
gcgatggagtttgcccaaaaagtcgaacacaaaatcaaaacccttgccgaagaagccgaa
cacgccaaacagtcgctgtctttgtttgaaaacttcggcttccgctacaccggccccgtg
gacggacacaacgtcgaaaatctggtggacgtattgaaagacttgcgcagccgcaaaggc
cctcagttgctgcacgtcatcaccaaaaagggcaacggctacaaactcgccgaaaacgac
cccgtcaaataccacgccgtcgccaacctgcctaaagaaagcgcggcgcaaatgccgtct
gaaaaagaacccaagcccgccgccaaaccgacctatacccaagtgttcggcaaatggctg
tgcgaccgggcggcggcagattcccgactggttgcgattacccccgccatgcgcgagggc
agcggcttggttgagtttgaacaacgattccccgaccgctatttcgatgtcggcatcgcc
gagcagcacgccgttacctttgccggcggtttggcttgcgaagggatgaagcccgtcgtg
gcgatttattccacctttttacaacgcgcctacgaccaactggtgcacgacatcgccctg
caaaacctacccgttttgtttgccgtcgaccgcgcgggcatcgtcggcgcggacggcccg
acccatgccggtctgtacgatttgagctttttgcgctgcgtgccgaacatgattgtcgcc
gcgccgagcgatgaaaacgaatgccgcctgttgctttcgacctgctatcaggcagacgcg
cccgccgccgtccgctatccgcgcggcacgggtacgggcgcgccggtttcagacggcatg
gaaaccgtggaaatcggcaagggcattatccgccgcgaaggtgagaaaaccgcattcatt
gccttcggcagtatggtcgcccccgcattggcggttgccgaaaaactgaacgccaccgtc
gccgatatgcgcttcgtcaaaccgatagacgaagagttgattgtccgccttgcccgaagc
cacgaccgcatcgttacccttgaagaaaacgccgaacagggcggcgcaggcggcgcggtg
ctggaagtattggcgaaacacggcatctgcaaacccgttttgcttttgggcgttgccgat
accgtaaccggacacggcgatccgaaaaaacttttagacgatttgggcttgagtgccgaa
gcggtggaacggcgtgtgcgcgcgtggctgtcggatcgggatgcggcaaattaa

DBGET integrated database retrieval system