KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1876Help
Entry
NMB1876           CDS       T00027                                 

Gene name
argA
Definition
(RefSeq) N-acetylglutamate synthase
  KO
K14682  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00220  Arginine biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    NMB1876 (argA)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     NMB1876 (argA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_4 FR47
Motif
Other DBs
NCBI-GeneID: 904312
NCBI-ProteinID: NP_274872
UniProt: Q9JXU9
Position
1979380..1980690
Genome map
AA seq 436 aa AA seqDB search
MSAPDLFVAHFREAVPYIRQMRGKTLVAGIDDRLLEGDTLNKLAADIGLLSQLGIRLVLI
HGARHFLDRHAAAQGRTPHYCRGLRVTDETSLEQAQQFAGTVRSRFEAALCGSVSGFARA
PSVPLVSGNFLTARPIGVIDGTDMEYAGVIRKTDTAALRFQLDAGNIVWLPPLGHSYSGK
TFYLDMLQTAASAAVSLQAEKLVYLTLSDGISRPDGTLAETLSAQEAQSLAEHAGGETRR
LISSAVAALEGGVHRVQILNGAADGSLLQELFTRNGIGTSIAKEAFVSIRQAHSGDIPHI
AALIRPLEEQGILLHRSREYLENHISEFSILEHDGNLYGCAALKTFAEADCGEIACLAVS
PQAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWFAERGFQTASEDELPETRRKDY
RSNGRNSHILVRRLHR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcccgacctctttgtcgcccacttccgcgaagccgtcccctacatccgccaa
atgcgcggcaaaacgctggtcgccggcatagacgaccgcctgctcgaaggtgatacctta
aacaagctcgccgccgacatcgggctgttgtcgcaactgggcatcaggctcgtcctcatc
cacggcgcgcgccacttcctcgaccgccacgccgccgctcaaggccgcacgccgcattat
tgccggggcttgcgcgttaccgacgaaacctcgctcgaacaggcgcagcagtttgccggc
accgtccgcagccgttttgaagccgcattgtgcggcagcgtttccgggttcgcgcgcgcg
ccttccgtcccgctcgtatcgggcaacttcctgaccgcccgtccgataggtgtgattgac
ggaaccgatatggaatacgcgggcgttatccgcaaaaccgacaccgccgccctccgtttc
caactcgacgcgggcaatatcgtctggctgccgccgctcggacattcctacagcggcaag
accttctatctcgatatgcttcaaaccgccgcctccgccgccgtctcgcttcaggccgaa
aaactcgtttacctgaccctttcagacggcatttcccgccccgacggcacgctcgccgaa
accctctcggcacaggaagcgcaatcgctggcggaacacgccggcggcgaaacgcgacgg
ctgatttcgtccgccgttgccgcgctcgaaggcggcgtgcatcgcgtccaaatcctcaac
ggagccgccgacggcagcctgctgcaagaactcttcacccgcaacggcatcggcacgtcc
attgccaaagaagccttcgtctccatccggcaggcgcacagcggcgacatcccgcacatc
gccgccctcatccgcccgctggaagaacagggcatcctgctgcaccgcagccgcgaatac
ctcgaaaaccacatttccgaattttccatcctcgaacacgacggcaacctgtacggttgc
gccgccctgaaaacctttgccgaagccgattgcggcgaaatcgcctgccttgccgtctcg
ccgcaggcacaggacggcggctacggcgaacgcctgcttgcccacattatcgataaggcg
cgcggcataggcataagcaggctgttcgcactgtccacaaataccggcgaatggtttgcc
gaacgcggctttcagacggcatcggaagacgagttgcccgaaacgcggcgcaaagactac
cgcagcaacggacggaactcgcatattctggtacgtcgcctgcaccgctga

DBGET integrated database retrieval system