KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1887Help
Entry
NMB1887           CDS       T00027                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00010  Glycolysis / Gluconeogenesis
nme00051  Fructose and mannose metabolism
nme00562  Inositol phosphate metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB1887 (tpiA)
   00051 Fructose and mannose metabolism
    NMB1887 (tpiA)
   00562 Inositol phosphate metabolism
    NMB1887 (tpiA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nme04147]
    NMB1887 (tpiA)
Enzymes [BR:nme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NMB1887 (tpiA)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NMB1887 (tpiA)
  Exosomal proteins of bladder cancer cells
   NMB1887 (tpiA)
  Exosomal proteins of melanoma cells
   NMB1887 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 904291
NCBI-ProteinID: NP_274883
UniProt: Q9JXT8
Position
1990609..1991382
Genome map
AA seq 257 aa AA seqDB search
MYRQIGMWDQKWVIGNWKMNGRLQNNNALMHRFRIHPTAERVLIGLAAPTVYLLQLHNAM
QIVLNNRILTCAQDVSRFPNNGAYTGEVSAEMLADTGTDIVLIGHSERSLYFGEKNEIQR
RKMENVLNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGT
GKVATVEQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGA
SLSYDSFTAIISAAQNA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgccaaatcggaatgtgggatcaaaaatgggtcatcggcaactggaaaatgaac
ggccggctccaaaacaacaacgcactgatgcaccgcttccgcatccaccccaccgccgaa
cgcgtcctcatcggactcgccgccccgaccgtttacctgctgcaactgcacaacgccatg
caaatcgttttaaacaaccgcatcctcacctgcgcccaagacgtgagccgcttccccaat
aacggcgcgtacaccggcgaagtgtccgccgaaatgctcgccgacaccggcacagacatc
gtcctcatcggacactccgaacgcagcctttatttcggcgaaaaaaacgaaatccaacgc
cgcaaaatggaaaacgtcctcaacgtcggactcatcccgttattgtgcgtcggcgaaagc
ctcgaagagcgcgaagccggcaaagaacacgaagtcatcgcccatcagctttccatcctg
caagggctggataccaaaaacatcgccgtcgcctacgaacccgtctgggcgatcggcacc
ggcaaagtcgccaccgtcgaacagattgccgatatgcacgcattcatctacaaagaaatc
ttgtctttgtgcggaagcgatgttaaaatccgcgtcctttacggcggaagtgtgaaagcg
gacaacgcggccgacatcttcgcagtaccttatgtggacggcgcactcgtcggcggcgcg
tcattgtcgtacgactcctttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system