KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1900Help
Entry
NMB1900           CDS       T00027                                 

Gene name
ppk
Definition
(RefSeq) polyphosphate kinase
  KO
K00937  polyphosphate kinase [EC:2.7.4.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00190  Oxidative phosphorylation
nme03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NMB1900 (ppk)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    NMB1900 (ppk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nme03019]
    NMB1900 (ppk)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.1  polyphosphate kinase
     NMB1900 (ppk)
Messenger RNA biogenesis [BR:nme03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     NMB1900 (ppk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP_kinase_C_1 PP_kinase_C PP_kinase PP_kinase_N PLDc_2 MR_MLE_C
Motif
Other DBs
NCBI-GeneID: 904271
NCBI-ProteinID: NP_274895
UniProt: Q9JXS9
Position
1999890..2002040
Genome map
AA seq 716 aa AA seqDB search
MPSETGADAAKPSDGIACPLRPNNNHLWENLMPEQNRILCRELSLLAFNRRVLAQAEDQN
VPLLERLRFLCIVSSNLDEFFEVRMAWLKREHKRCPQRRLDNGKMPSETIADVTEAARSL
IRHQYDLFNNVLQPELAQEGIHFYRRRNWTDTQKKWIEDYFDRELLPILTPIGLDPSHPF
PRPLNKSLNFAVELDGTDAFGRPSGMAIVQAPRILPRVVPLPSELCGGGHGFVFLSSILH
AHVGKLFPGMNVKGCHQFRLTRDSDLTVDEEDLQNLRAAIQNELHDREYGDGVRLEVADT
CPAYIRDFLLAQFKLTAAELYQVKGPVNLVRLNAVPDLVNRPDLKFPTHTPGRLKALGKT
ASIFDLVRQSPILLHHPYQSFDPVVEMMREAAADPAVLAVKMTIYRTGTRSELVRALMKA
ALAGKQVTVVVELMARFDEANNVNWAKQLEEAGAHVVYGVFGYKVHAKMALVIRREDGVL
KRYAHLGTGNYHQGTSRIYTDFGLITADEQITADVNILFMEITGLGKPGRLNKLYQSPFT
LHKMVIDRIARETEHAKAGKPARITAKMNSLIEPTVIEALYRASAAGVQIDLIVRGMCTL
RPGVKGLSENIRVRSIVGRQLEHARVYYFHNNGTDDTFISSADWMGRNFFRRIETATPIT
APELKKRVIHEGLTMALDDNTHAWLMQPDGGYIRAAPAEGESEADLQNDLWTLLGG
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaaaccggcgcagatgccgccaagccttcagacggcattgcctgcccgctc
cgaccgaacaacaaccatctttgggagaaccttatgcccgaacaaaaccgcatcctctgc
cgcgaactgagcttgctggcattcaaccgccgcgtgttggcgcaggcggaagaccaaaac
gtcccccttttggaacgcctgcgcttcctgtgcatcgtttcatccaacctcgacgagttt
ttcgaagtccgtatggcgtggctgaagcgcgaacacaaacgctgcccgcagcgcaggctg
gacaacggcaaaatgccgtctgaaaccatcgccgacgttaccgaagcggcgcgctccctg
atacggcaccagtacgacctgttcaacaacgtccttcagcccgagctggcacaagaaggc
atccatttttaccgccgccgaaattggacagacacacagaaaaaatggattgaagactat
ttcgaccgcgaattgctgccgatcctgacccccatcggactcgacccttcccaccccttc
ccgcgcccgctgaacaaatcgctcaacttcgccgtcgaactcgacggcacagacgcgttc
ggcaggccttcggggatggcgattgtgcaggcaccacgcatcctgccgcgcgttgttccc
ctgccgtccgaactgtgtggcggcggacacggcttcgtcttcctctcctccatcctgcac
gcccacgtcggaaaactcttcccgggcatgaacgtcaaaggctgccaccagttccgcctg
acgcgcgacagcgacttgaccgttgacgaagaagacctgcaaaacctccgcgccgccatt
caaaacgagttgcacgaccgcgaatacggcgacggcgtgcggctcgaagtcgccgacacc
tgtcccgcctacatccgcgactttctgctcgcgcaattcaaactgaccgccgccgaactc
tatcaggtcaaaggcccggtcaacctcgtgcgcctcaacgccgtccccgacctagtcaac
cgccccgatttgaaatttcccacacacacgccgggcagactgaaagccttgggcaaaacc
gcgtccatattcgatttggtgcgccaatcgcccatcctgctgcaccacccctaccaatcg
ttcgaccccgttgtcgaaatgatgcgcgaagccgccgccgaccccgccgtgcttgccgtc
aaaatgacgatttaccgcaccggcacgcgttccgaactcgtccgcgccctgatgaaggcg
gcactcgccggcaaacaagtaaccgtcgtcgtcgaactgatggcgcgttttgacgaagcc
aacaacgtcaactgggcgaagcagctcgaagaggcgggcgcgcacgtcgtgtacggcgtg
ttcggctacaaagtccacgccaaaatggcactggtcatccgccgcgaagacggcgtgctc
aaacgttacgcccatctcggcacgggcaactaccaccaaggcacatcgcgcatctacacc
gacttcggcctcattaccgccgacgaacaaatcaccgccgatgtgaacatattgtttatg
gaaatcacaggtttgggcaaacccgggcggctgaacaaactctaccaaagtccgtttacc
ctgcacaaaatggttatcgaccgcatcgcacgcgaaaccgaacacgcaaaagccggcaaa
ccggcgcggattaccgccaagatgaattcgctcatcgaaccgaccgtcatcgaagccctg
tatcgggcaagcgcggcaggcgtacaaatcgatttgattgtgcgcggtatgtgcaccttg
cgcccgggtgtaaaaggcttgtccgaaaacatccgcgtccgctccatcgtcggcaggcag
ctcgaacacgcgcgcgtgtattacttccataacaacggcacggacgatacctttatctcc
agcgcggattggatggggcgcaacttcttccgccgcatcgaaaccgccacgccgattacc
gcgcccgaactcaaaaagcgcgttatacatgaaggactgaccatggcactggacgacaac
acccacgcgtggctgatgcagcccgacggcggctatatccgcgccgcacctgccgagggc
gaatccgaagccgacctgcaaaacgatttgtggacactgctcggaggctga

DBGET integrated database retrieval system