KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1916Help
Entry
NMB1916           CDS       T00027                                 

Gene name
fabH
Definition
(RefSeq) 3-oxoacyl-ACP synthase III
  KO
K00648  3-oxoacyl-[acyl-carrier-protein] synthase III [EC:2.3.1.180]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00061  Fatty acid biosynthesis
nme01100  Metabolic pathways
nme01212  Fatty acid metabolism
Module
nme_M00082  Fatty acid biosynthesis, initiation
nme_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NMB1916 (fabH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nme01004]
    NMB1916 (fabH)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.180  beta-ketoacyl-[acyl-carrier-protein] synthase III
     NMB1916 (fabH)
Lipid biosynthesis proteins [BR:nme01004]
 Fatty acid synthase
  Component type
   NMB1916 (fabH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III_C ACP_syn_III Thiolase_N Chal_sti_synt_N FAE1_CUT1_RppA PorB SpoVAD tRNA_anti-like
Motif
Other DBs
NCBI-GeneID: 904246
NCBI-ProteinID: NP_274910
UniProt: Q9JXR6
Structure
PDB: 

Position
2013972..2014934
Genome map
AA seq 320 aa AA seqDB search
MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA
HRALDAAGLDSGEIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA
LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVLSASDTPGIIHSK
LKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIEEAGYTAAQ
IDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAASIPLALDTGIRSGQIKRGQ
NLLLEGIGGGFAWGAVLLQY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgcaaaaatttccggcacaggcagctatcttcccgccaaccgcgtcagcaat
gacgaccttgcccaaaaggtagatacctctgacgagtggattaccgcgcgcacgggcatc
aaattccgccatattgcagccgaaaacgaaaaaaccagcgatcttgccgccgaagcggcg
caccgcgcgctggatgcagccggattagacagcggcgaaatcgatttgattatcgtggca
acggcaacgccggatatgcagtttccgtctactgcgaccatcgtgcaacaaaaattgggc
atcaccaacggctgccccgcgtttgacgtacaggcggtgtgcgccggctttatgtacgcg
ctgaccacggcaaacgcctacattaaaagcggtatggcgaaaaacgcgctggtcatcggc
gcggaaaccttcagccgcattgtagactggaacgaccgcacaacctgcgtattgttcggc
gacggcgcgggcgcggtggttttaagcgcgtcggacacgccgggcatcatccacagcaaa
ctcaaggccgacggcaattatctgaaactcttaaacgtccccgggcaaatcgcctgcggc
aaagtttccggttcgccgtacatttcgatggacggtcccggcgtgttcaagtttgccgtc
aaaatgctgtccaaaatcgccgatgacgttatcgaagaagcaggttacaccgccgctcaa
atcgactggattgttccccatcaggcaaaccgccgcattatcgaatcgaccgcgaaacat
ttaggtttgagtatggacaaagtcgtcctgaccgtccaagaccacggcaacacatccgcc
gcatcgattccgctggctttggatacgggcatccgcagcggacaaatcaaacgcggtcaa
aacctgctgctcgaaggcatcggcggcggtttcgcgtggggcgcggtgctgttgcaatat
tga

DBGET integrated database retrieval system