KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1921Help
Entry
NMB1921           CDS       T00027                                 

Gene name
fabG
Definition
(RefSeq) 3-ketoacyl-ACP reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00061  Fatty acid biosynthesis
nme00780  Biotin metabolism
nme01040  Biosynthesis of unsaturated fatty acids
nme01100  Metabolic pathways
nme01130  Biosynthesis of antibiotics
nme01212  Fatty acid metabolism
Module
nme_M00083  Fatty acid biosynthesis, elongation
nme_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NMB1921 (fabG)
   01040 Biosynthesis of unsaturated fatty acids
    NMB1921 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMB1921 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    NMB1921 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nme01004]
    NMB1921 (fabG)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     NMB1921 (fabG)
Lipid biosynthesis proteins [BR:nme01004]
 Fatty acid synthase
  Component type
   NMB1921 (fabG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase CobU ADH_zinc_N 2-Hacid_dh_C CHASE2
Motif
Other DBs
NCBI-GeneID: 904233
NCBI-ProteinID: NP_274915
UniProt: Q9JXR1
Structure
PDB: 

Position
2020138..2020884
Genome map
AA seq 248 aa AA seqDB search
MSTQDLNGKIALVTGASRGIGAAIADTLAAAGAKVIGTATSESGAAAISERLAQWGGEGR
VLNSAEPETIESLIADIEKAFGKLDILVNNAGITRDNLLMRMKEEEWDDIMQVNLKSVFR
ASKAVLRGMMKQRSGRIINITSVVGVMGNAGQTNYAAAKAGLIGFSKSMAREVGSRGITV
NCVAPGFIDTDMTRALPEETRQTFTAQTALGRFGDAQDIADAVLFLASDQAKYITGQTLH
VNGGMLMP
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcacacaagatttaaacggcaaaatcgctttggtaacaggcgcatcgcgcggtatc
ggtgcagcaattgccgacacgctggcggcagccggtgccaaagtcatcggtacggcgacc
agtgagagcggtgcggcggcgattagcgagcggttggcgcaatggggcggcgaaggccgc
gtattaaattccgccgaacctgaaaccatcgaaagcctgattgccgacatcgaaaaagcg
ttcggcaaactcgatattctggtcaacaacgccggcatcacccgcgacaacctcctgatg
cgcatgaaagaagaagagtgggacgacatcatgcaggtcaacctcaaatccgtgttccgc
gcttctaaagccgttttgcgcggtatgatgaaacaacgttccggccgcatcatcaacatc
acatccgtcgtcggcgtgatgggcaatgccggtcaaaccaactatgccgcggcaaaagca
ggcttaatcggtttctccaaatccatggcgcgcgaagtcggcagccggggcattaccgtc
aactgcgtcgcccctggctttatcgataccgacatgacacgcgccctgccggaagaaacc
cgccaaacctttaccgcccaaaccgccttgggcagattcggcgacgcgcaagacatcgcc
gatgcggttctgttcctcgcttccgaccaagcaaaatacatcaccggccaaacgctgcac
gtcaacggcggtatgctgatgccttaa

DBGET integrated database retrieval system