KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1924Help
Entry
NMB1924           CDS       T00027                                 

Definition
(RefSeq) inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00521  Streptomycin biosynthesis
nme00562  Inositol phosphate metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    NMB1924
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMB1924
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     NMB1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 904231
NCBI-ProteinID: NP_274918
UniProt: Q9JXQ9
Position
complement(2022019..2022714)
Genome map
AA seq 231 aa AA seqDB search
MLSEADIAAQTAFAAALPLLIDSPMLGEEMSRQEQSALWEQYSGEKGLWIVDPIDGTNNF
VNGLPHFAVSVAFVRNGRAELGVIYNPVSGECFYAERGQGAFLNGTRLPLRLVDKKLNEA
IAGVEIKYLRSGKLSSRMSTLAPFGTIRSMGSSTLDWCYLACGRYDVYVHGGQKLWDYAA
GALIFEEAGGRLTTLEGDGFWSGEHVFKRSVVAALEPKLFERWVGWIRENQ
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgttgagcgaggcggacattgccgcgcagacggcttttgccgccgcgttgccgctttta
atcgacagtccgatgttgggtgaggaaatgtcgcggcaggaacagtcggctttgtgggaa
caatattcgggggaaaaggggctgtggattgtcgatccgatagacgggacgaacaatttt
gtcaacgggctgccgcattttgcggtatcggtggcgtttgtccgcaacgggcgcgccgag
ttgggcgtaatctacaacccagtcagcggcgaatgtttttatgccgaacgcgggcagggg
gcgtttttaaacgggacgcgtctgcccctgcgcctcgtggataaaaaactcaatgaggcg
attgcgggcgtggaaatcaaatatctgcgttcgggcaaactttccagccgtatgagtacg
ctcgcgccttttggaacgatacggagtatgggcagcagtacgttggattggtgttatctg
gcgtgcgggcgttatgatgtttatgttcacggcgggcagaagctgtgggattatgccgcc
ggcgcgttgattttcgaggaggcgggcggcaggctgacgactttggaaggcgacgggttt
tggagtggtgaacacgtgttcaaacgctcggtcgttgccgcgctcgaaccgaagctgttt
gaacgctgggtcgggtggatacgggaaaaccaatag

DBGET integrated database retrieval system