KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1926Help
Entry
NMB1926           CDS       T00027                                 

Gene name
lgtE
Definition
(RefSeq) lacto-N-neotetraose biosynthesis glycosyl transferase LgtE
  KO
K07270  glycosyl transferase, family 25
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    NMB1926 (lgtE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_25 BRD4_CDT
Motif
Other DBs
NCBI-GeneID: 904229
NCBI-ProteinID: NP_274920
UniProt: Q51117
Position
complement(2024879..2025721)
Genome map
AA seq 280 aa AA seqDB search
MQNHVISLASAAERRAHIAATFGVRGIPFQFFDALMPSEELNRMMAELVPGLAKQHLLSE
VEKACFMSHAVLWKQALDEGLPYVAVFEDDVLLGKDAEKFLAEDTWLEERFDKDSAFIVR
LETMFAKVIVRPDKVLNYENRSFPLLESEHWGTAGYIISREAMRFFLERFAVLPAEWIKA
VDWMMFTYFFDKEGMPVYQVNPALCTQELHYAKFLSKNSMLGSDLEKDREQERRHRRSLK
VMFDLKRALGKFGREKKKRMERQRQAELEKAYGRRVISFK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaccatgttatcagcttagcttccgccgcagaacgcagggcgcacattgccgca
accttcggcgtgcgcggcatcccgtttcagtttttcgacgcactgatgccgtctgaagaa
ctgaatcggatgatggcggaattggtgccgggattggcaaaacagcacctgttgagcgaa
gtggaaaaagcctgctttatgagccacgccgtattgtggaaacaggcattggatgaaggt
ctgccctatgttgccgtatttgaggatgatgtcctgcttggcaaagacgcagaaaagttc
cttgccgaagatacttggttggaagagcgttttgataaggattctgcctttatcgttcgt
ttggaaacgatgtttgcgaaagttattgtcagaccggataaagtcctgaattatgagaat
cggtcatttcctttgctggagagcgaacattgggggacggctggctatatcatttcgcgt
gaggcgatgcggtttttcttggaaaggtttgccgttttgccggcagagtggattaaagcg
gtagattggatgatgtttacttatttctttgataaggaggggatgcctgtttatcaggtt
aatcccgccttatgtacccaagaattgcattatgccaagttcctcagtaaaaacagtatg
ttgggtagcgatttggaaaaagatagggaacaagaaagaagacaccgccgttcgttgaag
gtgatgtttgacttgaagcgtgctttgggtaaattcggtagggaaaagaagaaaagaatg
gagcgtcaaaggcaggcggagcttgagaaagcttacggcaggcgggtcatatcgttcaaa
tag

DBGET integrated database retrieval system