KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1928Help
Entry
NMB1928           CDS       T00027                                 

Gene name
lgtB
Definition
(RefSeq) lacto-N-neotetraose biosynthesis glycosyl transferase LgtB
  KO
K07270  glycosyl transferase, family 25
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    NMB1928 (lgtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_25
Motif
Other DBs
NCBI-GeneID: 904227
NCBI-ProteinID: NP_274922
UniProt: Q51116
Position
complement(2025870..2026697)
Genome map
AA seq 275 aa AA seqDB search
MQNHVISLASAAERRAHIADTFGRHGIPFQFFDALMPSERLEQAMAELVPGLSAHPYLSG
VEKACFMSHAVLWKQALDEGLPYITVFEDDVLLGEGAEKFLAEDAWLQERFDPDTAFIVR
LETMFMHVLTSPSGVADYCGRAFPLLESEHWGTAGYIISRKAMRFFLDRFAALPPEGLHP
VDLMMFSDFFDREGMPVCQLNPALCAQELHYAKFHDQNSALGSLIEHDRLLNRKQQRRDS
PANTFKHRLIRALTKISREREKRRQRREQFIVPFQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaccacgttatcagcttagcttccgccgcagaacgcagggcgcacattgccgat
accttcggcaggcacggcatcccgtttcagtttttcgacgcactgatgccgtctgaaagg
ctggaacaggcaatggcggaactcgtccccggcttgtcggcgcacccctatttgagcgga
gtggaaaaagcctgctttatgagccacgccgtattgtggaagcaggcattggacgaaggt
ctgccgtatatcaccgtatttgaggacgacgttttactcggcgaaggtgcggaaaaattc
cttgccgaagacgcttggctgcaagaacgctttgacccggataccgcctttatcgtccgc
ttggaaacgatgtttatgcacgtcctgacctcgccctccggcgtggcggattactgcggg
cgcgcctttccgctgttggaaagcgaacactgggggacggcgggctatatcatttcccga
aaagcgatgcggtttttcctggacaggtttgccgccctgccgcccgaagggctgcacccc
gtcgatctgatgatgttcagcgattttttcgacagggaaggaatgccggtttgccagctc
aatcccgccttgtgcgcccaagagctgcattatgccaagtttcacgaccaaaacagcgca
ttgggcagcctgatcgaacacgaccgcctcctgaaccgcaaacagcaaaggcgcgattcc
cccgccaacacattcaaacaccgcctgatccgcgccttgaccaaaatcagcagggaaagg
gaaaaacgccggcaaaggcgcgaacagttcattgtgcctttccaataa

DBGET integrated database retrieval system