KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1970Help
Entry
NMB1970           CDS       T00027                                 

Definition
(RefSeq) para-aminobenzoate synthetase component I/4-amino-4-deoxychorismate lyase
  KO
K03342  para-aminobenzoate synthetase / 4-amino-4-deoxychorismate lyase [EC:2.6.1.85 4.1.3.38]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMB1970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nme01007]
    NMB1970
Enzymes [BR:nme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.85  aminodeoxychorismate synthase
     NMB1970
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.38  aminodeoxychorismate lyase
     NMB1970
Amino acid related enzymes [BR:nme01007]
 Aminotransferase (transaminase)
  Class IV
   NMB1970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Aminotran_4
Motif
Other DBs
NCBI-GeneID: 904171
NCBI-ProteinID: NP_274964
UniProt: Q9JXM6
Position
2065733..2067514
Genome map
AA seq 593 aa AA seqDB search
MPYFALFDDAVSGRAKRYQNHVESRFFRPEELDALDGALQSGWQKGLHSVLFADYGFGLP
LTGVESERGGNLALHWFANCADIDAESWLARHSDGLPAGISTPQPSVSETDYLDRIRQIH
EAIRRGDTYQINYTTRLHLQAYGNPVSLYRRLRQPVPYAVLSHLPDAEGQSAWTLCFSPE
LFLKIGSDGTISTEPMKGTAPILGDGQDERRAAELQADPKNRAENVMIVDLLRNDLGKIA
QTGTVCVPEPFKVSRFGSVWQMTSTIQAQALPHTSFADILRAAFPCGSITGAPKKMSMQI
IESLEAEARGLYTGSIGYLNPCSGGLGFEGTFNVVIRTLSLTPLSDGIYQGVYGVGSGIV
IDSDPAAEYRECGWKARFLNELRPDFGIFETLRAENGRCTLLDRHLCRLKTSAQALNLPL
PDGCENQIKQYIADLPDGAFRVKALLASDGISLSRAVLNRLTDKQRVIISPAVLPAQNYL
RRFKTTCRALFDQAWQTAETQGAFDSLFFNSDGILLEGGRSNVFIKHRGQWLTPSLDLDI
LNGIMRQAVLDEPQKYLQTNQVIETHITQKTLQEAEEIRLSNALRGVFAAALA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgccttatttcgccctgtttgacgatgccgtaagcggccgcgcaaaacgctatcaaaat
catgtggaaagccgttttttccgtcccgaagaactcgatgctttggacggcgcgctgcaa
tcgggctggcaaaaagggctgcattcggtgttgtttgcagactacggattcggtttgccg
ctgacgggggttgagtccgaacgcggcggcaatcttgccctgcactggtttgccaactgc
gccgacatcgatgccgaaagctggcttgcccgacactcagacggcctccccgccggcatt
tccacgccgcaaccctccgtatccgaaaccgattacctcgaccgcatccgccaaatccac
gaagccatccggcgcggcgacacctatcaaatcaactacaccacccgcctgcacctgcaa
gcctacggcaatcccgtcagcctctaccgccgcctgcgccagcccgtcccctatgccgtc
ttgtcccacctgcccgatgcggaggggcaatccgcgtggacgctgtgtttctcgcccgaa
ctcttcctcaaaatcggttcggacggcaccatcagcaccgaaccgatgaaaggcaccgcg
ccgattttgggcgacggacaagacgaacgccgcgccgccgagttgcaagcagacccgaaa
aaccgcgccgaaaacgtgatgattgtcgatttgctgcgtaacgatctcggcaaaatcgcc
caaaccggcacagtatgcgtacccgaaccgtttaaagtatcgcgtttcggcagcgtttgg
cagatgaccagcaccatccaagcccaagccttgccgcacacctcgttcgccgacatcctc
cgcgccgccttcccctgcggcagcatcaccggcgcgcccaaaaaaatgagtatgcagatt
atcgaatcgctcgaagccgaagcgcgcggactttatacgggcagcatcggctatttgaac
ccgtgttccggcggcttggggtttgaaggcacgttcaacgtcgttatccgcaccttgtcg
ctcacgccgctttcagacggcatttatcaaggcgtgtacggtgtcggttccggcatcgtc
atcgacagcgaccccgccgccgaatatcgcgaatgcggctggaaagcccgtttcctcaac
gaattgcgccccgacttcggcatttttgaaaccctgcgcgcggaaaacggacgctgcacc
ctgctcgaccgccacctatgccgtctgaaaacctccgcccaagccctcaacctgcccctg
cccgacggctgcgaaaatcaaatcaaacaatacattgccgacttgcccgatggcgcgttc
cgcgtcaaagccctgctcgcttcagacggcatcagcctgtcccgcgccgttttaaaccgt
ctgaccgacaaacaacgcgtcatcatttcgcccgccgtcctgcccgcacaaaactacctg
cgccgcttcaaaaccacctgccgcgccctcttcgaccaagcgtggcaaaccgccgaaaca
caaggcgcgttcgacagcctgtttttcaattcagacggcatcctgctcgaaggcggcaga
agcaacgtcttcatcaaacatcgcggacaatggctcacaccctctttagatttagacatt
ttaaacggcataatgcgccaagccgtattggacgaaccgcaaaaatatttgcaaacaaat
caagtaatcgaaacacacatcacacaaaaaacactgcaagaagccgaagaaatccgcctc
tccaacgccttgcgcggcgtatttgccgccgcccttgcctga

DBGET integrated database retrieval system