KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1981Help
Entry
NMB1981           CDS       T00027                                 

Definition
(RefSeq) S-ribosylhomocysteinase
  KO
K07173  S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00270  Cysteine and methionine metabolism
nme01100  Metabolic pathways
nme01230  Biosynthesis of amino acids
nme02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB1981
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    NMB1981
Enzymes [BR:nme01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     NMB1981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LuxS
Motif
Other DBs
NCBI-GeneID: 904156
NCBI-ProteinID: NP_274974
UniProt: Q9JXL8
Position
2077885..2078391
Genome map
AA seq 168 aa AA seqDB search
MPLLDSFKVDHTRMHAPAVRVAKTMTTPKGDTITVFDLRFCVPNKEILPGKGIHTLEHLF
AGFMRDHLNGNGVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWLASMQDVLNVKDQSKI
PELNEYQCGTYQMHSLAEAQQIAQNVLARKVAVNKNEELTLDEGLLNA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcccctactagacagtttcaaagtcgatcacacccgtatgcatgcccccgccgtacgc
gtggcgaaaaccatgactacgcccaaaggcgacaccattaccgtgtttgacctgcgcttt
tgcgttcccaacaaagaaatcctgcctggaaaaggcatacacacgctggagcatttgttc
gcaggttttatgcgcgaccacttgaacggcaacggcgtggaaatcatcgacatttccccg
atgggctgccgcaccggtttttatatgagtcttatcggcacgccttccgaacagcaggtc
gccgatgcgtggctggcttcgatgcaggatgttttgaatgtcaaagaccaaagcaaaatc
cccgagttgaacgaataccaatgcggcacttatcaaatgcactcgctcgccgaagcgcag
caaatcgcgcaaaacgtgttggcgcgcaaagtggcggtgaacaaaaatgaagagctgacg
ctggatgaagggctgctgaacgcctaa

DBGET integrated database retrieval system