KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2025Help
Entry
NMB2025           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    NMB2025
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     NMB2025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_CA
Motif
Other DBs
NCBI-GeneID: 904081
NCBI-ProteinID: NP_275017
UniProt: Q7DD53
Position
complement(2141865..2142464)
Genome map
AA seq 199 aa AA seqDB search
MSELDNILAHNRQFVESGEYEKYFTDKYPERGLAVLSCMDARIIGLLPDALGLKNGDAKL
IKNAGALVTHPWGSVMRSLLVAVFELKVREIMVIAHHDCGMQGLNAEEFLGRVRESRIPE
DRIETLRYAGIDLDGWLTGFDNVEDSVRHTVDLIRNHPLMPRHIAVHGLVIHPVTGKLTL
VVDGSVSDGMDLSEGMETS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagttggataacatccttgcccataaccggcagtttgtcgagtcgggcgaatat
gaaaaatactttaccgacaaataccccgaacgcgggctggcagttttgtcctgtatggat
gcgcggattatcgggctgctgcccgacgcgttgggtttgaaaaacggcgatgccaagctg
attaaaaatgccggcgcgctggttacgcacccgtggggttcggtgatgcggagccttttg
gttgccgtgtttgaactgaaggtcagagagattatggtcatcgcccatcacgattgcggt
atgcaggggctgaatgccgaagaattcctcgggcgcgtccgggaaagccggattcccgaa
gaccgtatcgaaaccctgcgttatgccggtatcgacctcgacggctggctgaccggtttc
gacaacgtcgaagacagcgtgcgccacacggtggaccttatccgtaaccatccgctgatg
ccgcgccatatcgccgttcacggactggtcatccatcccgttaccggcaaactgacgctg
gttgtggacggcagtgtttcagacggcatggacttatcggaaggaatggaaacatcatga

DBGET integrated database retrieval system