KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2028Help
Entry
NMB2028           CDS       T00027                                 

Gene name
gntK
Definition
(RefSeq) thermoresistant gluconokinase
  KO
K00851  gluconokinase [EC:2.7.1.12]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00030  Pentose phosphate pathway
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NMB2028 (gntK)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.12  gluconokinase
     NMB2028 (gntK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_18 SKI AAA_33 tRNA_lig_kinase AAA_14 Viral_helicase1 AAA_17 dNK AAA_28 AAA_22 APS_kinase
Motif
Other DBs
NCBI-GeneID: 904075
NCBI-ProteinID: NP_275020
UniProt: Q7DD52
Position
2145832..2146350
Genome map
AA seq 172 aa AA seqDB search
MTTHFVVMGVCGCGKTTAALSLQKHLGQCPYAEGDEFHTQANRDKMGAGIPLTDEDRYPW
LGNLRDWMTQQAQNGANHTIVTCSALKRGYRDILRGAEGKAAFIHLSPPQDINLERMMSR
KGHYMKAGMLDSQLEILEELGEGEYGVKIANPGTPEAVEADILNWVASENLL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgactacgcattttgtcgttatgggcgtatgcggctgcggcaagaccaccgccgcgctg
tccctgcagaaacacctcggtcaatgtccctatgccgaaggcgacgagttccacacccaa
gccaaccgcgacaagatgggcgcgggtattccgctgaccgatgaagaccgctatccgtgg
ttgggcaatctgcgcgactggatgacgcaacaggcgcaaaacggtgcgaaccacaccatc
gtaacctgttccgccctcaaacgcggctaccgcgacattctgcgcggagccgaaggcaaa
gctgccttcatccacctcagtccgccgcaagacatcaacctcgagcgcatgatgtcgcgc
aaaggacattacatgaaagcagggatgctcgattcgcaactggaaatcctcgaggaactg
ggcgaaggcgaatacggggtcaaaatcgccaaccccggcacgcccgaagcggtcgaagcc
gatattctgaactgggttgcctcggaaaacctgctttga

DBGET integrated database retrieval system