KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2029Help
Entry
NMB2029           CDS       T00027                                 

Gene name
thrB
Definition
(RefSeq) homoserine kinase
  KO
K02204  homoserine kinase type II [EC:2.7.1.39]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00260  Glycine, serine and threonine metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01230  Biosynthesis of amino acids
Module
nme_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB2029 (thrB)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     NMB2029 (thrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase
Motif
Other DBs
NCBI-GeneID: 903113
NCBI-ProteinID: NP_275021
UniProt: Q4W557
Position
complement(2146689..2147606)
Genome map
AA seq 305 aa AA seqDB search
MSVYTSVSDDEMRGFLSGYDLGEFVSLQGIAQGITNSNYFLTTTSGRYVLTVFEVLKQEE
LPFFLELNRHLSMKGVAVAAPVARKDGRLDSVLAGKPACLVACLKGSDTALPTAEQCFHT
GAMLAKMHLAAADFPLEMENPRYNAWWTEACARLLPVLSQDDAALLCSEIDALKDNLGNH
LPSGIIHADLFKDNVLLDGGQVSGFIDFYYACRGNFMYDLAIAVNDWARTADNKLDEALK
KAFIGGYEGVRPLSAEEKAYFPTAQRAGCIRFWVSRLLDFHFPQAGEMTFIKDPNAFRNL
LLSLG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtctataccagtgtttccgatgatgaaatgcgcggcttcctgagcggttacgat
ttgggggaatttgtttccctgcagggcatcgcgcaggggattaccaacagcaattatttt
ctgacgacgacttcgggacgttatgtgctgaccgtgtttgaagtgttgaaacaggaagag
ctgccgttttttctggagcttaaccggcatttgagtatgaagggcgtggcggttgccgcg
ccggttgcgcgcaaagacggccggcttgattccgttttggcgggtaagcctgcctgcctg
gttgcctgcctgaaaggttcggataccgcgctgccgacggctgagcagtgttttcatacc
ggtgcgatgttggcgaaaatgcaccttgccgccgccgatttccctttggaaatggaaaac
ccgcgttacaatgcgtggtggacggaggcgtgcgcccggctgctgcccgtcctgtcgcaa
gacgatgccgcactgctgtgttccgaaatcgatgcgttgaaggacaatctcggcaatcat
ctgccttcgggcatcatccatgccgatctgtttaaagacaatgtgttgcttgacggcggt
caggtatcgggcttcatcgatttctattacgcctgccggggcaattttatgtatgacttg
gcgattgcggtcaacgattgggcaaggacggcggacaataagttggatgaggcgttgaaa
aaggcgtttatcggcggttatgagggcgtgcgccccttgagtgccgaagaaaaggcgtat
ttcccgaccgcccaacgtgccggctgcatccgtttttgggtgtcgcgcctgttggatttt
cattttccgcaggcgggcgagatgacgtttatcaaagacccgaacgcgttccgcaacctg
ctgttgagtttgggttga

DBGET integrated database retrieval system