KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2045Help
Entry
NMB2045           CDS       T00027                                 

Gene name
ptsH
Definition
(RefSeq) sugar transport PTS system phosphocarrier protein HPr
  KO
K11189  phosphocarrier protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nme02000]
    NMB2045 (ptsH)
Transporters [BR:nme02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Phosphocarrier protein HPr [TC:8.A.8 4.A.2]
    NMB2045 (ptsH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS-HPr Med20
Motif
Other DBs
NCBI-GeneID: 904045
NCBI-ProteinID: NP_275035
UniProt: P65877
Position
complement(2168320..2168589)
Genome map
AA seq 89 aa AA seqDB search
MLKQSIEIINKLGLHARASNKFTQTASQFKSEVWVTKNDSRVNGKSIMGLMMLAAAKGTV
IELETDGADEAEAMRALTDLINGYFGEGE
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacaatccatcgaaatcatcaacaaactcggactccacgcccgcgcgtccaac
aagttcacccaaaccgcgtcccaattcaaaagcgaagtctgggttacgaaaaacgacagc
cgcgtcaacggcaaaagcattatggggctgatgatgctcgccgccgccaagggtacggtc
atcgaactggagacggacggcgcggacgaggcggaagcgatgcgcgccctgaccgactta
atcaacggctacttcggcgagggcgaataa

DBGET integrated database retrieval system