KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2062Help
Entry
NMB2062           CDS       T00027                                 

Gene name
thiF
Definition
(RefSeq) molybdopterin/thiamine biosynthesis family protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiF Sacchrp_dh_NADP NAD_binding_7 Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 904016
NCBI-ProteinID: NP_275052
UniProt: Q9JXG4
Position
2184502..2185272
Genome map
AA seq 256 aa AA seqDB search
MTTTEHDNDDAFLLRYSRHILLDEIGIEGQQKLSAAHILVVGCGGLGAAALPYLAASGVG
TLTIADSDTVELHNLQRQVAFDEGDVGKLKTEALAGRLKRINHTVNVRAVNEKLDGCRLT
GLVQAADIVLDCCDNYATRQAVNRACVQTKTPLVSGAAVRFEGQLAVYRPDLPDSPCYAC
LFDGGSASDGICSLFGVFSPLVGIIGSTQAAEALKILLDAGEPSHGRLAVYRALEGGWQY
FDLPRNPECPVCGTAR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaccgaacacgacaacgacgatgcattcctgctgcggtacagccgccacatc
ctcttggacgaaatcggcatcgaagggcagcagaaactttccgccgcgcatattttggtc
gtcggctgcggcggtttgggtgccgccgcactgccctaccttgccgcttcgggtgtcggc
acgctgaccatagccgattccgacacggtcgaactgcacaacctgcaacgccaagtcgca
tttgacgagggcgatgtcggcaaactcaaaaccgaagccttggcaggccgcctgaaacgc
atcaaccataccgtcaacgtccgcgccgtcaacgaaaaactcgacggctgccgcctgacc
ggtttggttcaagccgccgacatcgttttagactgttgcgacaactacgccacgcggcaa
gccgtcaaccgtgcctgcgtgcaaacgaaaacaccgctggtttcaggggcggcggtacgc
tttgaagggcaacttgccgtgtaccgtcccgacttgcccgactcgccgtgttacgcctgc
ctgtttgacggcggatcggcttcagacggcatctgttctctcttcggcgtgttctcgccg
ctggtcggcatcatcggcagtacccaagcggcggaggctctgaaaatcctgctggatgcg
ggcgaaccgtcgcacggcaggctggcggtttaccgtgccttggaagggggctggcaatat
ttcgacctgccgcgcaaccctgaatgcccggtttgcggcacagcgcgataa

DBGET integrated database retrieval system