KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2083Help
Entry
NMB2083           CDS       T00027                                 

Gene name
cysS
Definition
(RefSeq) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NMB2083 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nme01007]
    NMB2083 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nme03016]
    NMB2083 (cysS)
Enzymes [BR:nme01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     NMB2083 (cysS)
Amino acid related enzymes [BR:nme01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   NMB2083 (cysS)
Transfer RNA biogenesis [BR:nme03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    NMB2083 (cysS)
 Prokaryotic Type
    NMB2083 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 903970
NCBI-ProteinID: NP_275072
UniProt: Q9JXE6
Position
complement(2204591..2206012)
Genome map
AA seq 473 aa AA seqDB search
MTTIYNTLTRQKEPFSPIDPENVRMYVCGMTVYDYCHLGHARVMVVFDMIARWLRECGYP
LTYVRNITDIDDKIIARAAENGETIGKLTARFIQAMHEDADALGVLRPDIEPKATENIPQ
MIAMIETLIQNGKAYPAANGDVYYAVREFAAYGQLSGKSLDDLRAGERVEVDGFKRDPLD
FVLWKAAKAGEPAWESPWGNGRPGWHIECSAMSENLFGDTFDIHGGGADLQFPHHENEIA
QSVGATGHTCGHHHAQTHHGQSIASHVKYWLHNGFIRVDGEKMSKSLGNFFTIREVLKQY
DPEVVRFFILRAHYRSPLNYSDAHLDDAKGALTRLYTTLKNTPPADPMPSEAGDDYTRRF
YVAMNDDFDTVKAVAVLFELAGEVNKTNDAQLAGRLKALGGIIGLLQRDPTEFLQGGAAS
DGLSNEEIEDLIARRKQARADKNWAESDRIRDLLNEHKIILEDNAGGTTWRRG
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatctacaacaccctaacccgtcaaaaagaacccttttcccccatcgaccct
gaaaacgtgcgtatgtacgtctgcggtatgaccgtttacgattactgccatttgggacac
gcccgcgtgatggtggtgttcgacatgattgcccgttggttgcgcgagtgcggctatccg
ctcacttatgtacgcaacatcaccgacatcgacgataaaatcattgcccgcgcggctgaa
aacggcgagaccatcggcaaactgactgcgcgtttcatccaagccatgcacgaagatgcc
gatgctttgggcgtgttgcgtccggatattgagccgaaggcaacggaaaacattccgcaa
atgattgccatgattgaaaccctgattcaaaacggcaaggcatatcctgccgcaaatggc
gacgtttactacgccgtgcgcgagtttgccgcttacggacaattgtcgggcaaatcgttg
gacgacctgcgtgcgggcgaacgcgtggaagtggacggtttcaaacgcgatccgcttgat
tttgtgttgtggaaagccgccaaagcaggcgaaccggcgtgggaaagcccgtggggcaac
ggccgtccgggttggcacattgaatgctctgccatgagtgaaaacctgttcggcgatacc
ttcgacatccacggcggcggcgcggatttgcagtttccgcaccacgaaaacgaaattgcc
caaagcgtcggcgcgacggggcatacctgcggtcatcatcacgcgcaaacccaccacggg
caaagcatcgccagccacgtcaaatactggctgcacaacggctttatccgcgtggacggc
gaaaagatgtccaaatcgctgggcaacttcttcaccatccgcgaagtgttgaaacaatac
gatccggaagtcgtgcgcttcttcatcctgcgcgcccactaccgcagcccgttgaactat
tccgacgcgcatttggatgatgcaaaaggcgcgttgacgcgtttgtatacgactttgaaa
aatacgccgcccgccgatccgatgccgtctgaagccggcgatgactacacgcgccgcttt
tatgttgcgatgaatgatgattttgatacggtgaaagcggtggcggtgttgttcgaactt
gccggcgaagtgaacaaaaccaatgacgcgcaactggcaggccgtctgaaagccttgggc
ggcatcatcggactgctgcaacgcgatccgaccgagttcctgcaaggcggcgcggcttca
gacggtctctccaacgaagaaatcgaagacttgatcgcccggcggaaacaggcgcgcgcc
gataaaaactgggcggaatccgaccgcatccgcgaccttctgaacgaacacaaaatcatt
ttggaagacaacgccggcggcacgacttggcggcgcggttaa

DBGET integrated database retrieval system