KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2129Help
Entry
NMB2129           CDS       T00027                                 

Gene name
argG
Definition
(RefSeq) argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00220  Arginine biosynthesis
nme00250  Alanine, aspartate and glutamate metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB2129 (argG)
   00220 Arginine biosynthesis
    NMB2129 (argG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nme04147]
    NMB2129 (argG)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     NMB2129 (argG)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NMB2129 (argG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth QueC
Motif
Other DBs
NCBI-GeneID: 903396
NCBI-ProteinID: NP_275114
UniProt: Q9JXC1
Position
2236559..2237902
Genome map
AA seq 447 aa AA seqDB search
MSQNHTILQSLPVGQKVGIAFSGGLDTSAALLWMKLKGALPYAYTANLGQPDEDDYNAIP
KKAMEYGAENARLIDCRAQLAHEGIAAIQCGAFHVSTGGIAYFNTTPLGRAVTGTMLVSA
MKEDDVNIWGDGSTYKGNDIERFYRYGLLTNPALKIYKPWLDQQFIDELGGRHEMSEFLI
ANGFNYKMSVEKAYSTDSNMLGATHEAKDLEFLNSGIKIVKPIMGVAFWDENVEVSPEEV
SVRFEEGVPVALNGKEYADPVELFLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGM
ALFHIAYERLVTGIHNEDTIEQYRINGLRLGRLLYQGRWFDSQALMLRETAQRWVAKAVT
GEVTLELRRGNDYSILNTESPNLTYQPERLSMEKVEDAAFTPLDRIGQLTMRNLDITDTR
VKLGIYSQSGLLSLGEGSVLPQLGNKQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaaccataccattctgcaatccctccccgtcggtcagaaagtcggcatcgcc
ttctccggcggtcttgatacctctgccgcgctgttgtggatgaaactcaaaggcgcgctg
ccttatgcctacactgccaacctcggccagcccgacgaagacgactacaacgccattccc
aaaaaagcgatggaatacggtgcggaaaacgcccgcttaatcgactgccgcgcgcagttg
gcacacgaaggcatcgccgccatccaatgcggcgcgtttcacgtttccaccggcggcatc
gcctatttcaacaccacgcctctgggccgcgccgtaaccggcactatgcttgtttccgca
atgaaagaagacgatgtgaatatttggggcgacggcagcacctacaaaggcaacgacatc
gagcgtttctaccgctacggtttgctcaccaatcccgcgctgaaaatctacaaaccctgg
ctcgatcagcaatttatcgacgaactcggcggccgtcacgaaatgagcgaatttctgatt
gccaacggcttcaactacaaaatgtcggtggaaaaagcctactccaccgattccaatatg
ttgggtgccacccacgaagccaaagacttggaatttttgaactcgggcatcaaaatcgtc
aaacccattatgggcgttgccttttgggacgaaaacgtcgaagtcagcccggaagaagtc
agcgtacgctttgaagaaggcgtgccggttgcactaaacggcaaagaatacgccgatccc
gtcgaactcttcctcgaagccaaccgcatcggcggccgccacggcttgggtatgagcgac
caaatcgaaaaccgcatcatcgaagccaaatcgcgcggcatctacgaagccccgggtatg
gcgttgttccacatcgcctacgagcgtttggtcaccggcatccacaacgaagacaccatc
gaacaataccgcatcaacggcctgcgcctcggccgcctgctctaccaaggccgctggttc
gacagccaagccctgatgttgcgcgaaaccgcacaacgctgggttgccaaagccgttacc
ggcgaagttaccctcgaactgcggcgcggcaacgactactcaattctgaacaccgaatcg
cccaacctgacctaccaacctgaacgcctgagtatggaaaaagtcgaagacgctgcgttc
actccgctcgaccgcatcggacagctcacgatgcgcaacctcgacatcaccgacacccgc
gtcaaactgggtatctactcgcaaagcggtttgctctcgctgggcgaaggttcggtattg
ccgcagttgggcaataagcaataa

DBGET integrated database retrieval system