KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2133Help
Entry
NMB2133           CDS       T00027                                 

Definition
(RefSeq) serine/threonine transporter SstT
  KO
K07862  serine/threonine transporter
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nme02000]
    NMB2133
Transporters [BR:nme02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   NMB2133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDF DUF4148
Motif
Other DBs
NCBI-GeneID: 903354
NCBI-ProteinID: NP_275118
UniProt: Q9JXB8
Position
complement(2240197..2241426)
Genome map
AA seq 409 aa AA seqDB search
MAFGKSLFHAIGRVSLVRQIAAGLALGIVIGSVSPQLGLAAGLFGSLFVGALKAVAPVLV
FILVAATIAQHQKGNKAHIRPIIVLYLIGTFSAALTAVIAGMVFPTHIVLAGAGDVSAAP
PSGIVEVLKSLLMNLVANPINAIANANYIGILAWALVLGAALRNHGSDVTRQVVADLAEA
VSTVVKWIIRFAPLGIFGLVSSTIAETGFGALAGYAKLLAVLLGCMAFIALAVNPAIVWW
KIRRNPFPLVFTCLRESGVYAFFTRSSAANIPVNMALAKKLGLHEDTYSISIPLGATINM
AGAAITITVLAMAAAHTQGITVDFATALLLSLVATVSACGASGVAGGSLLLIPLACSLFG
IDNDVAMQVVAVGFIIGVIQDSAETALNSSTDVLFTAAADLGRQRNRAE
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcggcaaatccttatttcatgcgatcggccgcgtcagcctggtcaggcagatt
gccgccggtttggcgttgggcatcgtaatcggttcggtttccccgcaactgggcttggcg
gcaggcttgttcggcagcctgtttgtcggtgcgctcaaagcggtcgcgccggttttggta
tttattttggtggcggccacaatcgcgcagcaccaaaaaggcaacaaggcgcatatcagg
ccgattatcgtcctttacctcatcggtacgttttccgcagccctgaccgccgtcatcgcc
ggtatggttttcccgacgcacattgttttggcgggcgcgggcgatgtgtccgccgcgccg
ccttccggcattgtggaagtattgaaatcgctgctgatgaacctggtcgccaacccgatt
aacgcgattgccaatgccaactatatcggcattttggcttgggctttggttttgggcgcg
gcgttgcggaatcacggttcggacgttacgcggcaggtcgttgccgatttggcggaagcg
gtttccaccgtcgtgaaatggattatccgttttgcccctttgggcattttcgggctggtg
tcgtccacaatcgcggagacgggtttcggcgcgctggcggggtacgcgaagctgcttgca
gtgctgttgggctgtatggcgtttatcgcgctggcggtcaatcccgccatcgtgtggtgg
aaaatccgccgcaaccctttcccgctggtgtttacctgcctgcgtgaaagtggcgtttat
gccttctttacccgttcttccgccgccaatatccctgtgaacatggcattggcgaaaaag
ctgggtttgcacgaagacacttactccatctccattccattgggtgcaaccatcaatatg
gccggtgcggcaatcaccattaccgttttggcgatggctgcggcgcacacgcaaggcatt
acggttgacttcgccactgccctgctgctgagcctggtggctaccgttagcgcgtgcggt
gcatccggtgtggccggtggctcgttgctgctgattcctttggcgtgcagcctgttcggt
atcgataacgatgtggccatgcaggtggttgccgtcggcttcattatcggcgtgattcag
gattcggcggaaactgcgctgaactcttcgaccgacgttttgtttaccgctgccgccgat
ttgggccgacagaggaaccgggcggaataa

DBGET integrated database retrieval system