KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2157Help
Entry
NMB2157           CDS       T00027                                 

Definition
(RefSeq) pyrazinamidase/nicotinamidase PncA
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00760  Nicotinate and nicotinamide metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMB2157
Enzymes [BR:nme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     NMB2157
    3.5.1.-  
     NMB2157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-GeneID: 903215
NCBI-ProteinID: NP_275142
UniProt: Q9JX97
Position
complement(2266514..2267149)
Genome map
AA seq 211 aa AA seqDB search
MIVSIDVDAQKTFTPLCPDELPVNEGHLIVEELNAQAALADLRVMTKDAHHMVAKWLVDN
PVDMLKPTGLPDADLTWVAHAMVGTRGYELLDGLPSAKEYDYCVWKGVDPELHPYGACFH
DIEEKLSTGLIEWLRCQNTDTVIIGGLATDYCVKTTVLQLLKGGRWQVVVNEAACRGIAP
ETIETAWQEMHSAGAIILKNADEINKYINNQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttccattgatgttgatgcacaaaaaacgtttacgccactgtgtcctgacgaa
ctgcccgtgaacgaggggcatttgattgtcgaggagttgaatgcgcaagccgctttggcg
gatttgcgcgtgatgacgaaagatgcgcatcatatggtagcgaaatggcttgtggataac
cctgttgatatgttgaagccgacaggtttgcctgatgcggatttgacttgggtggctcat
gcgatggtcggtacgcgcggctatgaattattggacgggctgccttctgctaaagaatac
gattattgcgtttggaaaggtgttgatcctgaattgcatccttacggcgcgtgttttcac
gatattgaggaaaaactaagcacagggctgattgaatggctgcgttgtcaaaatacggat
acggttattatcggtgggttagctacggattattgtgttaaaacaacggttttgcagtta
ctcaaaggcggtcgttggcaggttgtcgtcaatgaagcggcttgtcggggtattgcgccg
gaaaccatcgaaacagcatggcaggaaatgcattctgctggggcaatcatcttaaaaaac
gctgatgaaataaataaatatattaataatcaataa

DBGET integrated database retrieval system