KEGG   Neisseria meningitidis MC58 (serogroup B): NMB2159Help
Entry
NMB2159           CDS       T00027                                 

Gene name
gapA-2
Definition
(RefSeq) glyceraldehyde 3-phosphate dehydrogenase C
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00010  Glycolysis / Gluconeogenesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB2159 (gapA-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nme04131]
    NMB2159 (gapA-2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nme04147]
    NMB2159 (gapA-2)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     NMB2159 (gapA-2)
Membrane trafficking [BR:nme04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NMB2159 (gapA-2)
Exosome [BR:nme04147]
 Exosomal proteins
  Proteins found in most exosomes
   NMB2159 (gapA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N
Motif
Other DBs
NCBI-GeneID: 903213
NCBI-ProteinID: NP_275144
UniProt: Q9JX95
Position
complement(2268201..2269205)
Genome map
AA seq 334 aa AA seqDB search
MSIKVAINGFGRIGRLALRQIEKAHDIEVVAVNDLTPAEMLLHLFKYDSTQGRFQGTAEL
KDDAIVVNGKEIKVFANPNPEELPWGELGVDVILECTGFFTNKTKAEAHIRAGARKVVIS
APGGNDVKTVVYGVNQDILDGSETVISAASCTTNCLAPMAAVLQKEFGVVEGLMTTIHAY
TGDQNTLDAPHRKGDLRRARAAALNIVPNSTGAAKAIGLVIPELNGKLDGSAQRVPVASG
SLTELVSILERPVTKEEINAAMKAAASESYGYNEDQIVSSDVVGIEYGSLFDATQTRVMT
VGGKQLVKTVAWYDNEMSYTCQLVRTLEYFAGKI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaaagtagcgattaacggtttcggccgcatcggccgcctcgcattgcgtcaa
attgaaaaagcccacgacatcgaagtcgtcgccgtcaacgacctgacccctgccgaaatg
ctgctgcaccttttcaaatacgacagcacacaaggccgtttccaaggtactgccgaatta
aaagacgatgccatcgtggtaaacggcaaagagatcaaagtttttgccaatccgaatccc
gaagaattgccttggggcgagttgggtgtggatgtcatcctcgaatgtaccggcttcttt
accaataaaaccaaagccgaagcacacatcagggccggcgcgcgcaaagtcgtgatttcc
gcacccggcggcaatgatgtgaaaaccgtcgtatatggcgtaaaccaagacattttggac
ggcagcgaaaccgttatctccgccgcttcctgcaccaccaactgccttgccccgatggcg
gcagtcctgcaaaaagagttcggcgtagtcgaaggtctgatgaccaccatccacgcctac
accggcgaccaaaacacccttgacgcgccgcaccgcaaaggcgatttgcgccgcgcccga
gccgccgcgctcaacatcgtgcccaacagcaccggtgccgccaaggccatcggtctggtt
atccccgaattgaacggcaaactcgacggctccgcccaacgcgtccctgttgccagcggc
tcgctgaccgaattggtttccatcctcgaacgccctgtaaccaaagaagaaatcaacgcc
gcgatgaaagccgccgccagcgaatcttacggctacaacgaagatcaaatcgtttcttcc
gacgttgtcggcatcgaatacggctcgctcttcgatgcgacccaaacccgcgtgatgacc
gtgggcggcaaacaattggtgaaaaccgttgcctggtacgacaacgaaatgtcctacacc
tgccaactcgtccgcactttggaatacttcgcaggcaaaatctaa

DBGET integrated database retrieval system