KEGG   Numida meleagris (helmeted guineafowl): 110387051Help
Entry
110387051         CDS       T06015                                 

Gene name
ERLIN2
Definition
(RefSeq) erlin-2
  KO
K23341  erlin
Organism
nmel  Numida meleagris (helmeted guineafowl)
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:nmel04121]
    110387051 (ERLIN2)
Ubiquitin system [BR:nmel04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    110387051 (ERLIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 DUF4346 POR_N
Motif
Other DBs
NCBI-GeneID: 110387051
NCBI-ProteinID: XP_021230440
Position
21
AA seq 342 aa AA seqDB search
MAQLGAIAALVLSFLAAAFLSAIHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK
SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLIQSAVYDIVKNYTADYDKALIFNKI
HHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTTMAPGLIIQAVRVTKPNIPETIR
RNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKIAQVAEITYGQKVMEKETEK
RISEIEDAAFLAREKARADAECYTAMKVAEANKLKLTPEYLQLMKYKAIAANSKIYFGKD
IPNMFMDYAGSQTKFSEGLAEGIHEEDGAGPSEDTKLLQNTN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctgggcgccatcgccgcgctcgtcctcagcttcctcgccgccgccttcctc
tccgccatccacaagatcgaggagggccacatcggcgtctactaccgcggcggcgcgttg
ctgacctccaccagcgggcccggcttccacctcatgctgcccttcatcacgtcctacaag
tcagtgcagaccacgctgcagaccgatgaggtgaaaaacgttccctgcggtacgagcgga
ggagtgatgatttactttgacagaattgaggtggtgaatttcctgatccagagtgcagta
tatgatatagtgaagaactacactgctgactatgacaaagctctcatcttcaacaagatt
caccatgagcttaaccagttctgcagtgtccacacgctccaggaggtctacatcgagctg
tttgatcagattgatgaaaaccttaaactggcattgcagcaagacctaactacaatggcc
cctggattaattatacaggcagttcgagttacaaagccaaacatccctgaaacaatccgg
aggaattatgagctcatggagagcgagaagaccaagctgctgattgcagcacagaagcag
aaggtggtggagaaggaagcggagacagagaggaagaaggccctcattgaggcagaaaaa
attgctcaagttgctgaaataacttatggacagaaagtgatggaaaaagaaacagagaaa
cggatttcagagattgaagatgctgcgtttcttgcaagagagaaggcaagagctgatgct
gaatgctatactgctatgaaagtagccgaagctaacaagctgaagttaactcccgagtac
ttgcagctgatgaaatacaaggctattgcagcaaacagcaagatttattttggcaaagat
attcccaacatgttcatggactatgcaggtagccagactaagttttcggagggactggca
gaaggaatccacgaagaggatggggcaggacctagtgaggacacaaaactgcttcagaac
accaactga

DBGET integrated database retrieval system