KEGG   Numida meleagris (helmeted guineafowl): 110387101Help
Entry
110387101         CDS       T06015                                 

Gene name
RETSAT
Definition
(RefSeq) all-trans-retinol 13,14-reductase
  KO
K09516  all-trans-retinol 13,14-reductase [EC:1.3.99.23]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110387101 (RETSAT)
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.23  all-trans-retinol 13,14-reductase
     110387101 (RETSAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_8 Amino_oxidase FAD_binding_2 FAD_oxidored Thi4 DAO MCRA FAD_binding_3 Pyr_redox_2 HI0933_like GIDA Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 110387101
NCBI-ProteinID: XP_021230567
Position
21
AA seq 610 aa AA seqDB search
MGLYAVLALLLLVLAVLTLCRWVGSRGPNPFAVDTRRPPAPLITDKAVRRNVLKAVFSPE
KVPAELDAIVIGSGIGGLAAAVLLAKVGRRVLVLEQHGRLGGCCHAFSEKGFEFDTGIHY
VGQLHDGSLWRFLVDQLTDGQLEWAPMPPSFDAVVLGEPGRDKAIHLCTGTRGYFERLKE
QFPGEEAAIDEFKRLVKSVTKGLWILGVLKMLPLPLVRLLSRSGLLSLLSPFCRMTLRSV
KDVVDGLTTNAKLRAVFSYIFPTYGVLPSKASFSLHSILVQHYLWGAWYPKGGSGEIVFH
TIPIIQKAGGNVLGRAPVQSILLDSQGRACGVSVKKGQDVVNIFAPIIISDAGIFNTYER
LLPPEARALPEIQSRLRMATHGEGGFTVFVGLRGSSRELGLEASNYYVYSDTNLDQIMRR
YYNCSRDEAAANIPLLFITSPSAKDPTWEMRYPGKSTLSIITMAKYEWFEEWKDKPVHKR
GDAYEDVKKTFVDTVMQTVFKLYPHIEDKVEYVSGGTPLTNQHYIASPRGEFYGMDHDMA
RTQIEAIATARPQTAIPNLYLTGQDVALCGFAGALQGAFLCTSAILKRNIYLDAIRLQKR
VKGSNGKKKD
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggggctgtacgcggtgctcgccctcctcctcctcgtcctcgccgtcctcaccttgtgt
cgctgggtcgggtcccgcggccccaaccccttcgctgtcgatacccggcgcccgccggct
ccgctgatcaccgataaggcggttcgtcggaacgtgctgaaagcagttttctctccagaa
aaagtcccggcggagctcgatgccatcgtcatcggcagcggcatcggggggctggcggcg
gccgtgctgctggccaaggtgggccggcgggtgctggtgctggagcagcacggcaggctg
gggggctgctgccatgccttcagcgagaagggcttcgagttcgacaccgggatccactac
gtggggcagctgcacgacggctcgctgtggcgcttcctggtggaccagctgacggacggg
cagctggagtgggctcccatgccgcccagcttcgacgccgtggtgctgggtgagcccggc
cgtgacaaagccatccacctctgcaccgggaccaggggttacttcgagcggctgaaggag
cagttccccggcgaggaagccgccatcgatgagttcaagcggctggtgaagagcgtcacc
aaagggctctggattctgggcgtgctgaaaatgctgccgctgccgctggtgcggctgctg
agccgctcggggctgctgtccctgctcagccccttctgccggatgaccttgcgtagtgtc
aaggacgtggtcgatggcctcaccaccaacgccaagctcagggccgtgttcagctacatc
ttccccacctacggtgtgctgccctccaaggccagcttctccctgcacagcatcctggtg
cagcactacctgtggggtgcctggtaccccaagggcggttcgggggagattgtcttccac
accatccccatcatccagaaggccggcggcaacgtgctgggccgggcaccagtgcagagc
atcctgctggactcccagggcagagcctgcggtgtgagcgtcaagaagggccaggacgtg
gtgaacatcttcgctcccatcatcatctcggacgcggggatattcaacacctacgagcgg
ctgctgccacccgaggcgcgcgctttgcctgagatccagtcccggctgcgcatggcgact
cacggcgaaggcggcttcaccgtcttcgtggggctcaggggctcaagccgggagctgggg
ctggaagccagcaactactacgtctactcggacaccaacctggaccaaataatgcggcgc
tactacaactgctcccgcgacgaggctgctgccaacatccccctgctgttcatcaccagc
ccgtccgccaaagaccccacgtgggagatgcggtacccaggtaaaagcacgctgtccatc
atcaccatggccaagtacgagtggttcgaggagtggaaagacaagccggtccataagcgg
ggagatgcttacgaggacgtgaagaagacctttgtggacaccgtcatgcagactgtcttc
aaactgtacccccacatcgaggacaaggtcgagtacgtctcgggggggacaccgctgacc
aaccagcactacatcgccagcccccggggggagttctacggcatggaccacgacatggcg
cgcacgcagatcgaagccattgccacggcgcggccgcagacggccatccccaacctctac
ctgacagggcaggacgtggctctgtgcggctttgccggagcgctgcagggagccttcctc
tgcaccagcgccatcctcaagcgcaacatctacctggacgccatccggctgcagaagcgc
gtgaagggctccaatggcaagaagaaggactga

KEGG   Numida meleagris (helmeted guineafowl): 110388620Help
Entry
110388620         CDS       T06015                                 

Definition
(RefSeq) putative all-trans-retinol 13,14-reductase isoform X1
  KO
K09516  all-trans-retinol 13,14-reductase [EC:1.3.99.23]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110388620
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.23  all-trans-retinol 13,14-reductase
     110388620
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 110388620
NCBI-ProteinID: XP_021233747
Position
26
AA seq 720 aa AA seqDB search
MQCACTVRISASHGLCAHVACTVQLCARRTRCVFMHAFCSAPAVQCVLAAGVMFACAVCA
WCMHCVHAVCMQATYACSTCECTVYVVCTPSACSTCVCRVCPRRVHACACSEHTMCMQYE
CVHALCIPYACSMCACSMQRVHAACACMQYAHPVHPLCTHACSVLTICMQYVHVHAMCLP
HACIMHTCMQSAYHMHAICVCMCTLRTIGMQYACTQRTSAPPVPAGIHYVGQMHEGSMLR
VVLDQLTDGQLCWQRLPDPYDEVALGPRRYQLRAGKAAFVAALEEQFPAEKAAIREFMRL
SKLASRHVALLALLKMVPRWLAAALVRTGLVHWVSPVFRMAATSHSEAVARLTADQDLRA
LLSYLFYGTAPRDSSFLVNVLMVHHYQRGAWYPRGGASEIAFHAVPLIERAGGAVLVRAP
VTRVLVDSGGTAVGVAVQKGSEEEEVEIRARVVISDAGIFNTFGKLLPAPLRIHPAIRSR
LDMVQHGMGSFLVFVGLRGSAAELDLPATNFWIYPHNDLDTMMSQYAALSREDVPENLAM
MFITFPAAKDPTYEERHPGRSCMTILTMARYEWFEEWAGTRAKHRGDDYVRYKAAIAQRL
LERALQRFPRLRDKVEFVEAASPLTNAHYLAAPRGEMYGTEHDLRRFSPAVVAAMRADTP
VRNLYLTGQDVFSCGLAGAVHGALLCASAVLGRVLYLDLLRLKRKVKAAARGVGTGTAPQ
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcgcgtgcaccgtgcgtatctctgcgtcgcatgggctgtgtgcacacgtagcc
tgcaccgtgcagctttgtgcgcggcgcacacggtgtgtgttcatgcatgcattctgcagt
gcaccggctgtgcagtgtgtgcttgcagcaggcgtgatgtttgcatgcgcagtgtgtgca
tggtgcatgcactgtgtgcatgcagtgtgtatgcaagcaacatatgcatgcagcacgtgt
gaatgcacagtgtatgtggtgtgcacaccgtctgcatgcagcacgtgtgtgtgtcgtgta
tgtccgcgccgtgtgcatgcatgtgcatgcagtgagcacaccatgtgcatgcagtacgag
tgtgtgcatgcattgtgcataccatatgcatgcagtatgtgtgcatgcagtatgcagcgt
gtgcatgcagcatgtgcgtgcatgcagtatgcacaccctgtgcatccgttatgtacacat
gcatgcagtgtgcttaccatatgcatgcagtatgtgcacgtgcatgcaatgtgcttaccc
catgcatgcattatgcatacatgcatgcagtctgcataccatatgcatgccatatgtgtg
tgcatgtgcactctgcgtaccataggcatgcagtatgcgtgcacacagcgcacatctgcc
cccccggtgcctgcaggcatccactacgtggggcagatgcacgagggcagcatgctgcgc
gtggtgctggaccagctgacggacgggcagctgtgctggcagcgcctgcccgacccctat
gacgaggtggccctgggtccacgccgctaccagctccgtgctggcaaggctgccttcgtt
gctgcgctggaggagcagttccccgcggaaaaggcagcgatccgggagttcatgaggctg
tccaagctggcctcccggcacgtggcgttgctggcgctgctgaagatggtgccgcggtgg
ctggcggccgcgctggtgcgcaccggcctggtgcactgggtgtcacccgtcttccgcatg
gcggccaccagccacagcgaggccgtggcccggctgacggccgaccaggacctgcgcgcc
ctgctcagctacctcttctatggcacggcgccgcgggactccagcttcctggtgaacgtg
ctgatggtgcaccactaccagcgcggcgcctggtacccgcgggggggggccagcgagatc
gccttccacgccgtgcccctcatcgagcgcgccgggggggccgtgctggtgcgcgctccc
gtcacccgcgtcctcgtcgactccggcggcaccgccgtgggggtggccgtgcagaagggc
agcgaggaggaggaggtggagatccgggcgcgcgtcgtcatctccgatgctgggatcttc
aacacctttggcaagctgctgcctgccccgctgcgcatccaccccgccatccgctcccgc
ctggacatggtgcagcacgggatgggctccttcctggtgttcgtggggctgcggggcagt
gcggctgagctggacctgcccgccaccaacttctggatctacccccacaacgacctggac
accatgatgagccagtatgccgccctgagccgcgaggacgtccctgagaacctggccatg
atgttcatcaccttccctgctgccaaggaccccacctacgaggagcggcatccaggccgc
tcgtgcatgaccatcctgaccatggcgcgctacgagtggttcgaggagtgggccggcacg
cgggccaagcaccgcggggacgactacgtgcgctacaaggcggccatcgcccagcgcctc
ctggaacgcgcgctgcagcgcttcccccggctccgcgacaaggtggagttcgtggaggcg
gcgtcgccgctgaccaacgctcattacctggcggcgccgcgcggggagatgtacggcacc
gagcacgacctgcggcgcttcagcccggccgtggtggcggccatgagggcggacaccccc
gtaaggaacctctacctgacggggcaggacgtgttcagctgcgggctggcgggggcggtg
cacggggcgctgctctgcgcctcggctgtgctgggccgcgtgctgtacctggacctgctg
cggctcaagaggaaggtcaaggcggcagcgcgcggcgtgggcacggggactgccccacaa
taa

DBGET integrated database retrieval system