KEGG   Numida meleagris (helmeted guineafowl): 110388681Help
Entry
110388681         CDS       T06015                                 

Gene name
RDH8
Definition
(RefSeq) retinol dehydrogenase 8 isoform X1
  KO
K11150  retinol dehydrogenase 8 [EC:1.1.1.-]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00830  Retinol metabolism
nmel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110388681 (RDH8)
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     110388681 (RDH8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Eno-Rase_NADH_b Epimerase
Motif
Other DBs
NCBI-GeneID: 110388681
NCBI-ProteinID: XP_021233884
Position
26
AA seq 376 aa AA seqDB search
MAMAPRTVLITGCSSGIGLALAVRLARDKQRRFRVIATVRNVSRSGALVAAAGSALGRTL
EVKQLDVCDEASIRACLDSIPGRRVDVLVSNAGVGMIGPLECQSLAAMQGLMDTNFFGLV
RLVKEVLPDMKRRRSGHIVVISSVMGLQGIVFNDVYAASKFAVEGFCESLVVQALRFNVA
FPPCSISLVEPGPVTTEFEAKVYEEAERADYSQTDPETAAIFTDLYLRNSRDVFASLGQS
PEDIAEHTLRVIEAARPPFRHQTNAAYTPMAALKHADPSGALMTEAFYKLVFKYGAVLRL
GLRAIRLLRWKAQKRRVKERSGFLRERSGRDRAGKGCQLHPPAPPGSSICGHAMPQPLLQ
ASDVGLEMHRVSSAPG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggccatggctccccgcaccgtgctgatcaccgggtgctcgtccggcattgggctggcg
ttggcggtgcgcctggcgcgggacaagcagcgccgcttccgagtcatcgccacggtgagg
aacgtgtcccgcagcggagcgctggtggcggcggcggggtcagcgctgggccggacgctg
gaggtgaagcagctggatgtgtgcgacgaggcgtccatccgcgcctgcctcgacagcatc
cctgggcgccgcgtcgatgtcctggtcagcaacgccggcgtggggatgatcgggccgctg
gagtgccagagcctggcagccatgcaggggctgatggacaccaacttctttgggctggtg
cgcctggtgaaggaggtgctgcccgacatgaagcgccgccgcagcggccacatcgtggtc
atcagcagcgtgatggggctgcagggcatcgtcttcaacgacgtctatgcagcctccaag
ttcgccgtggagggcttctgcgagagcctggtggtgcaggcgctgcgcttcaacgtggcc
ttccccccctgcagcatcagcctggtggagccggggccggtgaccactgagttcgaggcc
aaggtgtacgaggaggctgagcgcgccgactactcacagaccgaccccgagactgccgcc
atcttcaccgacctttacctgcggaactccagggacgtcttcgccagcctggggcagagc
cccgaggacatcgcggagcacacgctgcgggtgatcgaggcggcccggccgcccttccgg
caccagaccaacgcggcgtacacaccgatggccgcgctgaagcacgccgaccccagcggc
gcgctcatgaccgaggccttctacaaactggtgttcaagtacggcgccgtgctgcggctc
gggctgcgcgccatccgcctgctgcgctggaaggcccagaagcgccgggtgaaagagcgc
agcggcttcctccgagagcgcagcggccgtgacagggctgggaagggctgtcagctgcac
ccccctgcccccccaggctcctccatctgtgggcacgcaatgccacagcctcttctccaa
gcctctgacgtggggctggaaatgcaccgggtcagcagtgcaccaggttag

KEGG   Numida meleagris (helmeted guineafowl): 110389190Help
Entry
110389190         CDS       T06015                                 

Definition
(RefSeq) retinol dehydrogenase 16-like
  KO
K11154  retinol dehydrogenase 16 [EC:1.1.1.-]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00830  Retinol metabolism
nmel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110389190
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     110389190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-GeneID: 110389190
NCBI-ProteinID: XP_021234839
Position
32
AA seq 317 aa AA seqDB search
MWLWLLVLLGLWLLWRWHRERQTVPGLDEKFVLITGCDSGFGNVLARQLDARGLRVLAGC
LTEPGAAQLRAAASSRLQTVLLDVTSSSSIAAAAAWVQERVGERGLWGLVNNAGIAAPAA
PNEWLSKDDFVAVLNVNLVGLIEVTLSLLPLVKRARGRVVNVASVMGRLAFFGGGYCPSK
FGVEAFSDSLRLEMRHFGVKVSIIEPGYFKTAITNSPIVEKSFISIWERLPDETRASYGE
NYLQEFLAAMRAMQKKCNPNLSLVTDCMEHALTSCHPRYRYAAGWDAKLLYIPLSYLPSA
LSDTILSWSYPKPAQSA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgtggctgctggtgctgctggggctgtggctgctgtggcgttggcaccgcgag
cggcagacggtgcccggcctggatgagaagtttgtgctgatcacgggctgcgactcgggc
tttggcaacgtgctggcacggcagctggatgcgcgggggctgcgggtgctggcgggctgc
ctgacggagccaggggccgcacagctgcgggcagccgcctcgtcacgcctgcagaccgtg
ctcctggacgtcacctccagcagcagcatcgccgccgccgccgcctgggtgcaggagcgc
gtgggggagcgagggctgtgggggctggtgaacaacgccggcatcgccgcccccgccgcc
cccaacgagtggctgagcaaggacgacttcgtggcggtgctgaacgtcaacctggtgggg
ctgatcgaggtgacgctcagcctcctgccgctggtgaagcgggcgcggggccgcgtggtc
aacgtggccagcgtgatgggccggctcgccttcttcgggggggggtactgcccctccaag
tttggtgtggaggctttctccgacagcctgcggcttgagatgcggcacttcggggtgaag
gtgagcatcatcgagccgggctacttcaagacggccatcaccaactccccaatcgtggag
aagagcttcatcagcatctgggagaggctgcctgacgaaaccagagcgagttacggggag
aattacctgcaggagttcctggcagccatgcgggcgatgcagaagaagtgcaaccccaac
ctgtcgctggtgacggactgcatggagcacgcgctgaccagctgccacccgcgttaccgc
tacgcagccggctgggacgccaagctgctctacatcccgctcagctacctgccctccgcc
ctcagcgacaccatcctcagctggtcctaccccaaacccgcccagagcgcatga

KEGG   Numida meleagris (helmeted guineafowl): 110393823Help
Entry
110393823         CDS       T06015                                 

Gene name
RDH10
Definition
(RefSeq) retinol dehydrogenase 10 isoform X1
  KO
K11151  retinol dehydrogenase 10 [EC:1.1.1.-]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00830  Retinol metabolism
nmel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110393823 (RDH10)
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     110393823 (RDH10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-GeneID: 110393823
NCBI-ProteinID: XP_021242832
Position
2
AA seq 339 aa AA seqDB search
MNILLELFVVTFRVLWAFVLAAAKWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRR
ALLVLWDINTQSNEETAGMVRHIYRELAEAAPKVAGDGEKDALPHCSLQVYTYTCDVGKR
ENVYTTAERVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLP
KMLEMNHGHIVTVASSLGLFSTAGVEDYCASKFGAVGFHESLSHELKAAEKDGIKTTLVC
PYLVDTGMFRGCRIRKEIEPFLPPLKPEYCVKQAMRAILTDQPMICTPRLMYMVTFMKSI
LPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcctgctggagcttttcgtggtcaccttccgagtgctgtgggcgttcgtgctg
gccgctgccaagtggctggtgcggcccaaggagaagagcgtggctgggcaggtgtgcctg
atcaccggggcgggcagcggcctgggccgtctcttcgccctggagtttgcccggcgccgg
gcgctgctggtgctgtgggacatcaacacgcagagcaacgaggagacggcgggcatggtg
cgccacatctaccgcgagctcgccgaggccgcccccaaagtagctggagatggagagaaa
gacgcgctgccccattgcagcttgcaggtttacacatacacctgtgatgtgggcaaaaga
gaaaatgtctacacaacagcagagagggtccgcaaagaggttggcgaggtttccgtcctg
gttaacaatgctggtgtggtctctgggcaccaccttttggagtgtcctgatgagctgatt
gagaggaccatgatggtcaactgtcacgcgcatttctggaccactaaagcgttccttccc
aagatgctggaaatgaatcatggacacattgtgacagttgcgagttcattgggactgttc
agtactgctggagtagaggattattgtgctagcaaatttggagccgtaggttttcacgag
tctttgagccatgaactgaaagctgctgaaaaggatggaatcaaaacaactttagtctgc
ccttatcttgtagatacaggaatgttcagagggtgcaggatcagaaaagaaattgagcct
ttccttccaccgttgaaaccagaatactgtgtgaagcaggctatgagagctatccttaca
gaccagccgatgatctgcacacctcgcctcatgtatatggtcaccttcatgaaaagtatt
ctgccctttgaagcagttgtgtgcatgtaccggtttttgggagcagacaagtgtatgtac
cctttcattgctcaaaggaaacaggctacaaacaacaatgaagcaaaaaatggaatttaa

KEGG   Numida meleagris (helmeted guineafowl): 110401302Help
Entry
110401302         CDS       T06015                                 

Definition
(RefSeq) retinol dehydrogenase 12-like
  KO
K11153  retinol dehydrogenase 12 [EC:1.1.1.300]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00830  Retinol metabolism
nmel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110401302
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     110401302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Sacchrp_dh_NADP Epimerase Shikimate_DH AdoHcyase_NAD NAD_binding_10 GDP_Man_Dehyd Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 110401302
NCBI-ProteinID: XP_021257913
Position
6
AA seq 361 aa AA seqDB search
MVGDRLPPTRCYASRSRRASAIGRGDLRPRDRAPRRPGCRGGPGPAVPRCPSGRRSRSYP
RVPPLSCRRYVAGGRCMSAARLDGKVAVITGANTGIGKETARELARRGARVIVACRDIAK
AEAAASEIRAETDNQEVIVKKLDLADTRSIREFANSFLAEEKELHILINNAGVMLCPYSK
TADGFEMHLGVNHLGHFLLTFLLLERLKQSAPARIVNVSSLAHHGGRIRFHDLHGEKSYN
RGLAYCHSKLANVLFTRELARRLQGTKVTANSLHPGSVHSELVRHSFVMTWLWRIFSFFL
KTPWEGAQTSVYCAVAEELETVTGQYFSDCRPAYVSPWGRDDETAKKLWNVSCELLGIQW
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggtgggcgaccgcctcccgccgactcggtgctacgcgtcgcgttcccgccgcgcttcc
gccatcggccgcggggacctgcgcccgcgcgacagggcgcctcggcgcccggggtgtcgc
ggcgggcccggcccggccgtgccgcggtgcccgagcggtcggcgaagtcggagctaccct
cgagtcccgccgctctcttgcaggcggtacgtggccggagggcggtgcatgtccgcggcc
aggctggacgggaaggtggcggtgatcacgggcgccaacaccggcatcgggaaagagacc
gccagggagctcgcccggagaggtgcgagggtgattgttgcctgcagagacatagcaaag
gcagaagctgcagcaagtgaaatccgagctgagacagataatcaggaagtcatcgtgaaa
aagctggacttggctgataccaggtccatccgggagtttgctaacagctttctagcagag
gagaaggagctccatattctcattaataatgctggggtaatgttatgcccttactccaag
acagctgatggctttgagatgcacctgggagtaaatcatcttggtcattttcttctaacc
ttcttattgctggagcgtctgaagcagtctgcacctgcccggatagtgaacgtgtcctca
ctggctcatcacggaggccgaatccgcttccacgacctccatggtgagaagagctacaat
cgtggcctcgcctactgtcacagcaagttggccaacgtccttttcacccgagagctggca
aggcggctgcaaggcactaaagtcacagcaaactctctccatcctgggtctgtccattct
gagctggtccggcactcgtttgtaatgacgtggctgtggaggatattctcattcttcttg
aagactccatgggaaggagctcagaccagtgtgtactgtgcagtagcagaggagctagaa
actgtgacaggacaatatttcagtgattgccggccagcatatgtatctccatggggtcgg
gatgatgagacagcaaagaagctctggaatgtgagctgtgagctcctcggcatccagtgg
gactga

KEGG   Numida meleagris (helmeted guineafowl): 110402562Help
Entry
110402562         CDS       T06015                                 

Definition
(RefSeq) retinol dehydrogenase 8-like
  KO
K11150  retinol dehydrogenase 8 [EC:1.1.1.-]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00830  Retinol metabolism
nmel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110402562
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     110402562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR GDP_Man_Dehyd Eno-Rase_NADH_b DUF3294 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 110402562
NCBI-ProteinID: XP_021260482
Position
7
AA seq 317 aa AA seqDB search
MARRNVLITGCSSGIGLALAVKMAKDDQERFKVYATMRNLAKKDALEEAAGHKLGKTLEI
KQLDVCDEQSIKTCVNSIPDRRIDVLVSNAGMGLIGPIECQTIDEMKTVMDTNFFGLVRL
LKEILPDMKKRKSGHIVIISSVMGIQGILFNDVYAASKFAVEGFCESLAIQALKFKLQLS
LIEPGPVVTEFERKVFEDGMKMDLSAADEETADMFTNIYLKNYKQIFQSLGQSAEEVAEH
TVKIILAENPPFRHQTNTLYTPMTTLKYADPNGDLPIDIFYKMVFHHDKIFSASLNFIKL
LRWRSRKSFDLGKSSSQ
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaagaaacgtccttattacaggttgctcctcaggaattggattggccttagct
gtaaaaatggcaaaagatgatcaggaaagatttaaagtgtatgccacaatgcggaatctg
gccaagaaagatgcactcgaggaagctgcaggtcataaactgggcaaaaccctggaaatt
aaacaactggatgtctgtgatgaacagtccattaaaacttgtgtgaatagtatccctgac
agaaggattgatgtcctagttagcaatgctggaatggggctcattggaccaattgaatgt
cagactatcgatgaaatgaaaactgtgatggataccaacttctttggactggttcgactc
ctgaaggagattttgcctgacatgaagaagagaaagagcgggcatatagttataataagc
agtgttatgggaatacaaggtatcttatttaatgatgtttatgctgcatctaagtttgcg
gtggaaggattctgtgaaagtttagctatacaagcactcaagttcaagctgcagttaagt
ttgattgaaccaggtccagtggttacagaatttgaaagaaaagtgtttgaagacggaatg
aaaatggatctttcagctgcagatgaggaaacagctgacatgtttactaatatctacctt
aaaaattacaaacaaattttccagagcctaggacaaagtgctgaggaagttgcagagcat
acagtaaagataatacttgcagaaaatccaccttttcgtcatcagaccaacaccttgtat
acacctatgacaacactgaaatatgcagatccaaatggagatctacccattgatatattc
tacaaaatggtttttcatcatgacaaaatcttcagtgcaagtcttaacttcatcaaattg
ctgaggtggagaagcagaaaaagctttgacctgggaaaatcctcatcacaataa

DBGET integrated database retrieval system