KEGG   Numida meleagris (helmeted guineafowl): 110389229
Entry
110389229         CDS       T06015                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
nmel  Numida meleagris (helmeted guineafowl)
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nmel04040]
    110389229 (ASIC1)
Ion channels [BR:nmel04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   110389229 (ASIC1)
SSDB
Motif
Pfam: ASC DUF4074
Other DBs
NCBI-GeneID: 110389229
NCBI-ProteinID: XP_021234894
Position
32
AA seq 599 aa
MMDLKVDEEEVDSGQPVSIQAFASSSTLHGISHIFSYERLSLKRVVWALCFMGSLALLAL
VCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLN
NRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQC
SPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDET
SFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEF
YDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYC
VCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIE
QKKAYEVAGLLGEHSGLMAVPRAVVGILQWGPICCDPNSGAPGCAYSMGAEQSTRQGQSS
DKFCPFSAPSASSALLMAFLSSPGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCRRG
KCRKNHKRNNTDKGVALSMDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgatggacctgaaggtggacgaggaggaggtggacagcgggcagccggtgagcatccag
gccttcgccagcagctccaccctgcacgggatctcgcacatcttctcctacgagcggctg
tcgctgaagcgcgtggtctgggcgctctgcttcatgggttcgctggcgctgctcgccctg
gtctgcaccaaccgcatccagtactacttcctctacccgcacgtcaccaagctggacgag
gtggccgccaccaggctcaccttccccgccgtcaccttctgcaacctcaacgagttccgc
ttcagccgcgtgaccaagaacgacctgtaccacgccggggaactcctcgccctgctcaat
aacagatacgagatcccggacacgcagacggctgacgagaagcagctggaaatcctgcag
gacaaggcgaacttccgaaacttcaagcccaaacctttcaatatgttggagttttacgac
cgtgctggccacgacatccgggagatgctgctctcctgcttcttccgcggggagcagtgc
agccccgaagacttcaaagtggtgttcacacgctatgggaagtgctacaccttcaatgcg
gggcaggacggcaaaccccggctcatcaccatgaaggggggcactggcaatggcctggag
atcatgctggacatccagcaggacgagtatctcccagtgtggggggaaacagatgagacc
tcttttgaagctgggatcaaggtgcagatccacagccaggacgagcctccacttatcgac
cagctgggctttggtgtggcacccggcttccagaccttcgtgtcctgccaggagcagcgg
ctcatctacctgccacctccctggggcgactgtaaggccacaacgggcgactcagagttc
tacgacacctacagcatcaccgcctgccgcatcgactgcgagacccgctacctggtggag
aactgcaactgccgcatggtgcacatgccaggtgatgccccttactgcaccccagagcag
tacaaggagtgcgcagatccagccttagattttctggtggagaaggacaacgagtactgt
gtctgtgagatgccctgcaatgtcacccgctatggcaaagagctctccatggtgaaaatc
cccagcaaagcctctgccaagtacctggccaagaagtacaacaagtcggagcagtacatc
ggggagaacatcttggtgctggacatcttttttgaagccctgaactatgagacaattgag
cagaagaaggcatacgaggtggctggattgctgggtgagcactctgggctgatggctgtg
ccgagggctgtggttggcatccttcaatggggccccatatgctgtgaccccaattctggg
gcaccagggtgtgcatacagcatgggtgcagagcagagcacccgccagggtcaaagcagt
gacaagttctgccctttctctgctccatctgccagcagtgccctgctgatggctttcctc
tcctccccaggtgacatcggaggacagatggggctgtttattggggccagcatcctcact
gtgctggagctgtttgactacgcctacgaggtgatcaagcaccggctgtgccggcggggc
aagtgccgcaagaaccacaagaggaataacacggacaagggcgtcgcgctgagcatggat
gacgtgaaacgccataacccctgtgagagcctacggggtcacccggccggcatgacgtac
gcagcgaacatcctacctcaccacccagcccggggcacctttgaggacttcacctgctaa

DBGET integrated database retrieval system