KEGG   Numida meleagris (helmeted guineafowl): 110389462
Entry
110389462         CDS       T06015                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nmel01002]
    110389462 (ERAP1)
Enzymes [BR:nmel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     110389462 (ERAP1)
Peptidases and inhibitors [BR:nmel01002]
 Metallo peptidases
  Family M1
   110389462 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 110389462
NCBI-ProteinID: XP_021235603
Position
Z
AA seq 1027 aa
MTALVQLTVVPFGSKRLVLITQLLNRKRPPYQFPVAGALPARPPPGDGTLELTRPRRAPP
SPAARWARRAALPSLSLSLPGVARARRPQVAAACSRSTMAAPRWEVVVLGLASVAWCVSR
AQGGGGSAQFPWDRVRLPGHVVPLHYHLLIHPNLTTLTFTGTVAIDVTVTQPTRAVVLHS
KRLRVSRAGLEAGAGSTCAVREVRVLEHPSREQLALLASEPLCTGHNYTLSIQYSANLSD
SFHGFYKSTYRTREGELRVLASTHFEPTSARMAFPCFDEPAFKARFSVKIRREPNHLALS
NMPLVKSVNIASWLVEDHFDTSVKMSTYLVAFIVSDFKSISKVTSRGVKVSIYTVPEKIN
QAHYALDAAVKLLDFYEDYFSIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLYDPE
KSSASSRLWITMVIAHELAHQWFGNLVTMEWWNDLWLNEGFAKFMELLSVNITHPELRVE
DYFLRRCFDAMEVDALNSSHPVSTPVEDPAQILEMFDEVSYEKGSCILNMLRDYLTADVF
KAGLVQYLQKYSYQNTKNEDLWDSLTNICPTVGTDKGELQGDGFCRRNQQSSSNAHWTKE
TLDVKAMMDTWTLQKGFPLLTITVRGKNVHLQQEHYRKGADSLSPTENGYLWHIPLTYVT
SNSHTVQRFLMRTKTDVIILPEEAEWIKFNVDMNGYYIVHYEDDGWDRLISLLRENHTMI
SSNDRASLINNIFQLVRIKKLSISKAFDLTLYMKRETQIMPILQGMNELVPIYKLMERRD
MDDTEKQLKDYIVNLFKDLIDKQLWSDEGSVSERMLRQSLLLFACVRRYQPCVDKAEEYF
SKWQKSNGTLRLPADVKTAVYAVGAQTSEGWDFLLSKYQHHSFSVDKDKIASALSLTRNK
DKLQWLMDEGLRGDIIKTQDFPYIIVSIARNPSGYHLAWTFLRENWEKLIKKFELGSSSI
AGIVTGVTNQYSTRPQLAQVKEFFSSLEEKSAQLRCIQQAIETIEDNIQWMDRYFDEIKM
WLQKNHP
NT seq 3084 nt   +upstreamnt  +downstreamnt
atgacagcacttgttcaacttacagtagtaccctttggcagcaaacgccttgttttaatc
acacagctactcaacagaaaacggccgccttatcagtttccagttgccggagccctaccg
gccaggccgccgccgggggacggcaccctagagctgacacggccccgccgcgctcctccc
tcccccgcggcgcgatgggcgcggcgcgctgcgctgccttcgctttcgctttcacttccc
ggcgtcgcgcgggcccgcaggccgcaggtggccgccgcctgcagccggtccacgatggca
gcgccgcgctgggaggtggtggtgctggggctggcgagcgtggcgtggtgtgtcagccgt
gcccagggcggtggcggcagcgcgcagtttccctgggacagggtgaggctccccgggcac
gttgtgccgctgcactaccacctcctcatccatcccaacctcaccacgctcaccttcacc
ggcaccgtggccatcgatgtcacggtcacgcagccaacgagggcggtcgtcctccatagc
aaacgcctgcgcgtcagcagggctggcctcgaggcgggggccgggagcacctgcgcggtg
cgggaggtgagggtgctggagcacccatcccgcgagcagctggcactgctggcctccgag
ccgctgtgcaccgggcacaactacaccctcagcatccagtactcagcgaacctctccgac
tccttccacggcttctataagagcacctacagaacccgggaaggagaactcagagtgctt
gcatcaacacactttgagccaacctctgcaagaatggccttcccctgcttcgatgaacca
gctttcaaagccaggttttcagttaagattaggagggaaccaaatcaccttgccttgtcc
aatatgccactggtgaagtccgtgaatatagcttcatggcttgttgaggaccattttgat
accagtgtcaagatgagtacttaccttgtggcctttattgtttcggattttaaatccatc
agcaaagtaaccagtcgtggagttaaggtttccatctacacagtaccagagaagatcaac
caggctcattatgcgctggatgcagcagtaaaacttttagacttttatgaggactacttc
agcattccctaccccttaccaaagcaagatttagcagctattcctgattttcagtctggt
gctatggaaaactgggggttgaccacatatcgggaatcagcgttgctgtatgatcctgaa
aagtcctcagcatcctctaggctttggattactatggttatagcccatgagctggctcac
cagtggtttggcaacctagttaccatggagtggtggaatgatctgtggttaaacgaaggg
tttgcaaagtttatggagctcctgtccgtaaacattacccatccagaactgagagttgaa
gattatttcttaagaagatgctttgatgccatggaggtagatgcattaaattcatcccat
cctgtgtctactcctgtggaggatccagctcaaattttagaaatgtttgatgaggtttca
tacgagaagggatcttgcatattaaatatgctgagggactacctgactgccgatgtgttt
aaggctggacttgtacagtacctacagaaatacagctatcagaatacaaagaatgaagat
ttgtgggacagtttgacaaatatttgtcccacagtaggtactgacaaaggtgaactacag
ggtgacggcttttgcagaagaaaccaacagtcatcttcaaatgcacactggaccaaagag
actcttgatgtgaaggcaatgatggacacttggacactgcaaaaaggttttcccctgcta
accatcacagtgagaggaaagaatgtccacctgcagcaggagcactacagaaaaggagca
gattctctttcacccacagaaaacgggtacttgtggcacattccactaacctacgttacc
agcaactctcacactgttcaaagatttttgatgagaaccaaaacagatgtcattatcctt
ccagaagaagctgaatggattaaattcaatgtggacatgaatggttattacattgtgcac
tatgaagatgatggatgggatcgtctgatcagccttttgagagagaaccatacaatgatt
agcagcaatgacagagcaagtctcattaataatatcttccagcttgtgagaataaaaaaa
ctgtcgatttctaaagcttttgatttaactttatacatgaaacgggaaacacagatcatg
cccatactccaaggtatgaacgagctggttcctatatacaagctcatggagcggagggat
atggatgacacagaaaaacagttaaaggactatatagtcaatctatttaaggacctaatt
gacaagcagctttggagtgatgaaggctcagtgtcagagagaatgcttcggcaatccctg
ctgctgtttgcatgcgtgcgcaggtaccagccctgtgtggacaaagcagaagagtatttt
tcgaaatggcagaaatccaatggaaccttaaggctgccagcagatgtgaagacagcagtg
tatgccgttggagcacaaacatctgaaggttgggatttcctccttagcaaataccagcac
cactccttcagtgtagacaaagataaaattgcatccgctctcagcctcaccaggaataag
gacaaacttcagtggctaatggatgaaggtctgcgtggtgacatcataaaaactcaggat
tttccatatattattgtgtccattgccagaaacccatctggctatcatcttgcttggacc
ttcttaagggaaaactgggagaaactcatcaaaaaatttgaactcggttcatcttccata
gcaggcattgtcactggagtgacaaatcagtattcaacaaggccacagcttgcacaggta
aaagaattcttcagttctctggaggaaaaaagtgcgcaacttcgttgcatccagcaagcc
attgaaaccattgaggacaacatacaatggatggatagatattttgatgaaatcaaaatg
tggctgcaaaagaaccacccataa

DBGET integrated database retrieval system