KEGG   Numida meleagris (helmeted guineafowl): 110389558Help
Entry
110389558         CDS       T06015                                 

Gene name
NLN
Definition
(RefSeq) neurolysin, mitochondrial isoform X1
  KO
K01393  neurolysin [EC:3.4.24.16]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nmel01002]
    110389558 (NLN)
Enzymes [BR:nmel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.16  neurolysin
     110389558 (NLN)
Peptidases and inhibitors [BR:nmel01002]
 Metallo peptidases
  Family M3
   110389558 (NLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M3
Motif
Other DBs
NCBI-GeneID: 110389558
NCBI-ProteinID: XP_021235883
Position
Z
AA seq 702 aa AA seqDB search
MRFQLAVVQQRSWSIGPRLLLRMTLGAEITNQLKASSYIASGRNLLRWDLSPEQIRTRTE
ELIRKTKHVYDIVGKLNIEEVTHENTLQALADIEVEYAVERSMLDFPQHVSPDKEVRLAS
TEADKKLSNFDVEMSMREDVFQKIVYLQQTCNFENVKPETKRYLDKSVQVGKRNGLHLPK
EVQHEIMMMKKKLSELCIDFNKNLNEENMFLVFSKEELEGLPDDFIKSLEKTEEDKYKIT
LKYPHYFPVMKKCCISETRRKMESAFNTRCKEENTKILQQLLPLRAKVAELLGYNTHANF
VLEVNTAKSTDNVTTFLDDLSKKLKPLVEKEREFILDLKKKECQERNCDYDGRINAWDLH
YYMNKTEELKYSIDQEKLKEYFPIEAVTEGLLNIYQRLLGLVFERVESAHVWHDSVTLYT
VRDNSTGETLGQFYLDLYPREGKYGHAACFGLQPGCLLSDGSRMMSVAALVTNFTKPGSD
RPSLLRHDEVKTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMFENWVWEKEPL
QQMSRHYKDESHVEDALLEKLAASRLANTGLLTLRQIVLSKVDQALHTKPSVDPGDEYAK
YCMEILGIPATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDIFYSCFKQEGIMNPKAG
MKYRNLILKPGGSLDGMDMLQNFLERKPSQRAFLLSKGLCVQ
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgagattccaacttgcagtagtccagcagagaagctggtccattgggcctcgacttttg
ttgagaatgacattaggagcagaaatcactaaccagctcaaggcttcttcatacatagca
tcaggccgaaacctcttgagatgggacctgtcgccagagcaaattagaacaagaacagaa
gaactaatcaggaagacaaaacatgtgtatgacatcgttgggaagcttaatattgaagaa
gtgacacatgaaaatactttacaggccttggcagatatagaagtggaatatgcagtggaa
agaagcatgttggattttccccagcatgtctcacctgataaagaggtacgcttagcaagt
acagaagctgacaaaaagctttccaatttcgatgtggagatgagcatgagggaagatgtg
tttcagaagattgtttatttgcagcaaacctgcaattttgaaaatgtaaagcctgaaaca
aagcggtacctagacaaatcagttcaagtgggaaaaagaaatggactccatcttcctaaa
gaagtacaacatgaaataatgatgatgaagaaaaaattaagtgagctgtgtatagacttc
aacaaaaatctgaatgaggaaaacatgtttcttgtattttccaaagaggagctcgaaggc
cttcctgatgactttattaagagtttagagaagactgaggaagacaaatataaaataact
ttaaaatatcctcactattttcctgttatgaagaaatgctgcatttcagaaaccaggaga
aaaatggaatctgcctttaacacaaggtgcaaagaggagaacacaaaaattcttcagcag
ttgcttccactaagggcaaaagtagcagagttgcttggttataatacacacgccaacttt
gttctggaggtaaacactgcaaagagcacagataacgtaacaaccttcttagatgatttg
agtaagaagctaaagccactggttgagaaggaaagagaattcattctagatttgaagaaa
aaggagtgtcaagagagaaactgtgattatgatggaagaatcaatgcatgggaccttcat
tattatatgaacaaaacagaagagctgaagtactccatagatcaagaaaagctgaaggaa
tacttcccaattgaggctgttacggaaggcttattgaatatttaccagaggctacttgga
cttgtatttgagcgagtagaaagtgctcatgtttggcatgacagtgttactctttataca
gtaagggacaattcaacaggagaaacgttagggcagttctatttggacctttaccctcga
gagggaaagtatgggcatgcagcatgctttggtctccagcctggctgtcttctctctgat
ggcagtagaatgatgtctgtggctgctctagtaaccaatttcacaaaaccaggatcagat
cgcccatcattgctgcgacatgatgaagtaaagacatacttccatgaatttggtcatgta
atgcatcagatatgtgcacagactgattttgctaggtttagtggaactaatgtggaaact
gacttcgtagaggtaccttcacaaatgtttgagaactgggtgtgggaaaaagaaccacta
cagcaaatgtcaagacattacaaagatgagagccatgttgaagatgctctccttgagaaa
cttgctgcatctaggctggctaatacaggtcttttaacgctccgccagattgttttgagc
aaggttgaccaggcgcttcatacaaagccatctgttgacccgggagatgaatatgccaaa
tactgtatggagatcctaggaattcctgcaaccccaggaacaaacatgccagctaccttt
ggacacctggcaggtggttatgatggacagtactatggatacctctggagcgaagtgttt
tccatggacatcttttatagctgctttaagcaagaaggcataatgaatccgaaggctggg
atgaaatacagaaatcttattttgaaacccggaggatctttggatgggatggatatgctt
cagaatttcttggagcgcaaaccaagccagagagctttcctgctgagtaagggactatgt
gttcagtaa

DBGET integrated database retrieval system