KEGG   Numida meleagris (helmeted guineafowl): 110390486Help
Entry
110390486         CDS       T06015                                 

Gene name
ECHS1
Definition
(RefSeq) enoyl-CoA hydratase, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00062  Fatty acid elongation
nmel00071  Fatty acid degradation
nmel00280  Valine, leucine and isoleucine degradation
nmel00310  Lysine degradation
nmel00380  Tryptophan metabolism
nmel00410  beta-Alanine metabolism
nmel00640  Propanoate metabolism
nmel00650  Butanoate metabolism
nmel01100  Metabolic pathways
nmel01200  Carbon metabolism
nmel01212  Fatty acid metabolism
Module
nmel_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
nmel_M00085  Fatty acid elongation in mitochondria
nmel_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    110390486 (ECHS1)
   00650 Butanoate metabolism
    110390486 (ECHS1)
  09103 Lipid metabolism
   00062 Fatty acid elongation
    110390486 (ECHS1)
   00071 Fatty acid degradation
    110390486 (ECHS1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110390486 (ECHS1)
   00310 Lysine degradation
    110390486 (ECHS1)
   00380 Tryptophan metabolism
    110390486 (ECHS1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110390486 (ECHS1)
Enzymes [BR:nmel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     110390486 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 110390486
NCBI-ProteinID: XP_021237503
Position
Unknown
AA seq 301 aa AA seqDB search
MAVSLRALLRTSAGVCAGAARCRAFLAAFRPLLVGRGCSDGPPFRFLQVQKAGAGGSVGL
IRLQRPEALNALCEGLMEELRCALDTFEADGRVGAIVITGSEKAFAAGADIKEMQNKTFQ
DCYGGSFLAGWDRVATVRKPTIAAVNGFALGGGCELAMMCDIIYAGEKAQFGQPEVLLGT
IPGAGGTQRLTRAVGKSLAMEMVLTGERISAAEAKAAGLVSKVFPTDKLLDAAIGCAEKI
ASNSKLVVAMAKESVNAAFETTLTEGNRTEKRLFYATFATDDRKEGMTAFVEKRKANFTD
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcggtctcgctgcgcgccctcctccgcaccagtgccggtgtctgcgccggtgccgcg
cggtgccgcgcattcctggcggcattccgcccccttctggtggggcgggggtgcagcgac
gggcccccgttccgcttcctgcaggtgcagaaggctggggcgggcggcagcgtgggcctg
atccggctgcagcggcccgaggcgctcaacgcactctgtgagggactgatggaggagctt
cggtgcgcacttgacacctttgaggctgacgggcgggtgggagctattgtcatcaccggc
agtgagaaggcctttgcagctggtgctgacatcaaagagatgcagaacaaaaccttccag
gattgctatggcggtagcttcctggctggctgggaccgggtggccactgtccgcaagccc
accatcgctgctgttaatggctttgctctgggcggagggtgtgaactggccatgatgtgt
gatatcatctatgctggggagaaggcgcagtttggacagcccgaggtcttgctggggaca
atcccaggtgccggcgggacacagaggctgaccagggcagtgggcaagtcactggccatg
gagatggtgctcactggagagcggatctcggcagcagaggccaaggcagcaggtctggtc
agcaaagtcttccccacggacaagctgctggatgcagccattggctgcgctgaaaagatc
gcttccaactccaagctggtggtggctatggccaaggagtccgtcaatgccgcctttgaa
acaacactgacagaggggaacaggacagagaaacgcctcttctatgccacttttgccact
gatgaccgcaaggaagggatgactgcatttgtggagaagcgcaaggccaacttcactgac
agctga

KEGG   Numida meleagris (helmeted guineafowl): 110397114Help
Entry
110397114         CDS       T06015                                 

Gene name
HADHA
Definition
(RefSeq) trifunctional enzyme subunit alpha, mitochondrial
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00062  Fatty acid elongation
nmel00071  Fatty acid degradation
nmel00280  Valine, leucine and isoleucine degradation
nmel00310  Lysine degradation
nmel00380  Tryptophan metabolism
nmel00410  beta-Alanine metabolism
nmel00640  Propanoate metabolism
nmel00650  Butanoate metabolism
nmel01100  Metabolic pathways
nmel01200  Carbon metabolism
nmel01212  Fatty acid metabolism
Module
nmel_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
nmel_M00085  Fatty acid elongation in mitochondria
nmel_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    110397114 (HADHA)
   00650 Butanoate metabolism
    110397114 (HADHA)
  09103 Lipid metabolism
   00062 Fatty acid elongation
    110397114 (HADHA)
   00071 Fatty acid degradation
    110397114 (HADHA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110397114 (HADHA)
   00310 Lysine degradation
    110397114 (HADHA)
   00380 Tryptophan metabolism
    110397114 (HADHA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110397114 (HADHA)
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     110397114 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     110397114 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 110397114
NCBI-ProteinID: XP_021248742
Position
3
AA seq 770 aa AA seqDB search
MAAAVRAIGSLGRFAAAAKYCPPRRSAAEGYACRNVSTSTALQARTHVSCDIKGDVAVVR
FNTPNSKVNTLSKQLSAEFTEVMNEIWANEAVKSAVLISSKPGSFIAGADIDMITACKTS
QEVTQLSQEGQKMLEKIEQSPKPVVAAISGSCLGGGLEVAIACHYRIATKDRKTILGLPE
VLLGLLPGAGGTQRLPKMVGLPAAFDMMLTGRNIHADRAKKMGLVDQLVDPLGPGVKPPE
ARTIEYLEEVAIGFARGLANKTVSSKRSKGLVQKITDYAMALPFVRQQVYKTVESKVQKQ
TKGLYPAPLKIIEVVKAGLDQGRDAGYLTESQSFGHLAMTNESKALIGLYHGQVRCKKNK
FGTPQREVKTLAVLGAGLMGAGIAQVSVDKGMKTILKDTTQQGLDRGQQQVFKGLNGKVK
KKSLTSFERDSILSNMTGQLDYKGFEKADMVIEAVFEDINIKHKVLKEVEAVIPPHCIFA
SNTSALPINKIAAVSQRPEKVIGMHYFSPVDKMQLLEIITTDKTSQDTAASAVAVGLKQG
KVVIVVKDGPGFYTTRCLGPMLAEVGRVLQEGIDPKKVDAISTAFGFPVGAATLIDEVGV
DVATHVAEDLGKAFGERFGGGSIDLFKLMVQKGFLGRKAGKGFYIYQEGVKNRSLNSGMD
EILAQFKLPAKPEVCTDEDIQMRLVTRFVNEAAMCLQEGILSNPVEGDIGAVFGLGFPPC
LGGPFRFADSYGAKQLVDKLRKYEAVYGSQFTPCQLLLDYANNPGKKFHQ
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcagtgcgcgctatcggcagcttggggcgtttcgcggccgctgctaagtat
tgcccgccccgccgctcggcggctgagggctacgcttgccgtaatgtctccacctccact
gctcttcaggctagaacccacgtgagctgtgatatcaaaggagatgttgctgttgtacgc
ttcaacacaccaaattcaaaggtgaacactctatccaaacaattgagtgcagagtttact
gaagttatgaatgagatttgggctaatgaagcagtcaaaagtgccgtcctcatctcctca
aagccaggttctttcattgctggagcagatattgacatgattacagcctgcaagacttct
caggaagtgactcagctctctcaggaaggacagaagatgctagaaaaaattgagcagtct
ccaaagcccgtagttgctgccatcagtggttcctgcctgggaggaggactggaggttgcc
attgcctgtcactacagaatagcaacaaaggacaggaaaacaatcttgggattacctgaa
gtattactgggactcctgccaggggcggggggaactcagcggctgccaaagatggtggga
cttcctgctgcctttgacatgatgctgactgggaggaacatccatgctgatagagcgaag
aagatgggtctggttgaccagctggtggacccactagggccaggtgtgaagcctccagaa
gctcgaacaattgaatacttggaggaggtagcaattggctttgccaggggactagccaac
aagactgtgtcttccaagcgctcgaaaggactagtacagaagataacagactatgcaatg
gctcttccatttgtgaggcagcaagtctacaagacagtggagagcaaagttcagaagcaa
accaaaggactgtatcctgctccactgaaaatcattgaggttgtaaaagctggtcttgat
caggggcgtgatgctggatacctcactgaatcccagagttttggccaccttgcaatgacc
aatgaatccaaggcgctgatcggactttaccacgggcaagtgcgctgcaagaagaacaag
tttggaacacctcagcgagaggtcaagaccctggcagtgctgggagcagggctcatggga
gctgggattgcacaggtctcagtggataaggggatgaagaccattctgaaggacacaacg
cagcaaggcttggacagaggacagcagcaagtcttcaaggggctgaatggcaaggtgaag
aagaagagtctaacatcatttgagagggactctattctcagcaacatgacaggccagcta
gactacaagggctttgagaaagcagacatggtgatcgaggctgtgttcgaggacattaac
atcaagcacaaagtgctgaaggaagtggaggccgtgatccctcctcactgtatcttcgcc
agtaacacgtctgccctcccaatcaataaaattgctgctgttagccagaggccagagaag
gtgattgggatgcactacttctcccccgttgacaaaatgcagctgctggaaatcatcact
acagacaaaacatcccaggacacagctgcttctgctgttgctgttggcctcaaacaaggc
aaagtcgtcattgtggtaaaggatggacctggtttctacaccaccagatgcctggggcca
atgttggccgaagtgggccgagttctccaggagggcattgacccaaagaaagtagatgcc
atctctacagcctttggctttccagtgggtgctgccacactgattgatgaggtgggtgtg
gacgtggccacacacgtggctgaggaccttggcaaggcctttggcgagcgctttggaggc
ggcagcatcgatttgttcaagctcatggtgcagaaaggcttcttaggccgcaaggcaggg
aagggtttctacatttaccaggagggggtgaaaaacaggagcttgaattctggcatggat
gagatcttggcacagttcaagttgccagccaagcctgaagtctgtactgatgaggacatc
cagatgcgcttggtgaccaggtttgtgaacgaggcagccatgtgcctgcaggaagggatc
ctcagcaaccccgtggagggagacattggtgctgtgtttggcttgggcttcccaccttgc
ctgggaggtcccttcaggtttgcggactcctacggtgccaagcagctggtggacaagctg
cggaagtacgaggccgtctatggcagccagttcacgccgtgccagctgctgctggactac
gccaacaacccaggcaagaagttccaccagtga

KEGG   Numida meleagris (helmeted guineafowl): 110398159Help
Entry
110398159         CDS       T06015                                 

Gene name
EHHADH
Definition
(RefSeq) peroxisomal bifunctional enzyme
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00071  Fatty acid degradation
nmel00280  Valine, leucine and isoleucine degradation
nmel00310  Lysine degradation
nmel00380  Tryptophan metabolism
nmel00410  beta-Alanine metabolism
nmel00640  Propanoate metabolism
nmel00650  Butanoate metabolism
nmel01100  Metabolic pathways
nmel01200  Carbon metabolism
nmel01212  Fatty acid metabolism
nmel03320  PPAR signaling pathway
nmel04146  Peroxisome
Module
nmel_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
nmel_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    110398159 (EHHADH)
   00650 Butanoate metabolism
    110398159 (EHHADH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110398159 (EHHADH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110398159 (EHHADH)
   00310 Lysine degradation
    110398159 (EHHADH)
   00380 Tryptophan metabolism
    110398159 (EHHADH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110398159 (EHHADH)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110398159 (EHHADH)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    110398159 (EHHADH)
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     110398159 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     110398159 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     110398159 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 SeleniumBinding NAD_binding_2 TrkA_N
Motif
Other DBs
NCBI-GeneID: 110398159
NCBI-ProteinID: XP_021251234
Position
4
AA seq 726 aa AA seqDB search
MAQYARGAAAVAVIRLRNPPVNALSLTVLQALEDGLKRADADPSVKAVTICGENGKFSAG
ADIRGFSSPEKQGLGLGPVVSLIERSEKPVVAAIEGIALGGGLEVALGCHYRIAHVQARM
GLPEVTIGLLPGGEGTQRLPRLVGVPAALDIITTGRHIPAIEALKLGLVDEVVEESTVEA
AIRLANKLIGQPLGPRRLSLKPVPKLPNMEAFLSDALVKVKKRAQGCLAPELCFQAIKAA
TEQPFAEGVQKERELFNILLTSGQAKALQYAFFAERAVEKWTTPSGASWKSASPQPIRKA
AVIGLGTMGRGIVTSLVKAKIPVVALEQDLEYLNMGRKAVMLLLEREAMKMEQGAQTLDF
HNPARLQFSVDFDVLRDVDLVIEAVFENMALKKEIFNKLSRICKPEAFLCTNTSALNIDE
IASVTSRPQQVIGTHFFSPAHVMRLLEIIYGHHTSPTAIATAMQLAKVMKKVGVVVGNCF
GFVGNRMMFPYVQQAVFLLEEGSRPEDVDQVLEDFGFKIGPFRMSDLAGLDVGWRSRKDQ
GLTGPSLAPGTPARQRHGYRYSPLPDLLCEKGRFGQKNGKGWYQYEKAGGRTAKPDPWIH
SFLSEYRDSHQIKTCFIDQEEILERCLFTLINEGFDILAEGIASGPEHLDVVYINGYGWP
KHRGGPMFYASTVGLPNILAKLQKYSEIHPDVPQLHPSAFLKKLVAMGSPPLSDWMSYLH
RQSNKL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtacgcgaggggcgccgcggccgtggccgtcatccggctccgcaacccacct
gtcaacgcgctgagtttgacagttctccaggcattagaggatggactgaaaagagcagat
gcggatccttcagtgaaagctgttacaatttgtggtgaaaatgggaaattcagtgcaggt
gctgatattcgagggttttcttctccagagaaacagggtcttggcttgggccccgtagtt
tctctcatagaaaggagtgagaagcctgttgtggctgccattgaaggcattgccttggga
ggaggcctggaggtggcacttggctgtcactatcgtatcgcacatgtgcaggcacggatg
gggttaccagaagtcacaattgggttgcttccaggtggtgaaggcactcagcggctcccc
agattggttggggttcctgctgctctggatatcattactacaggaagacacattccagca
attgaagcactgaagctgggcttggttgatgaagttgtggaagagagcacagttgaagca
gcaattcgtttggcaaacaagttgattggccagcccttgggaccccgcaggctcagcctg
aagccagtcccaaaattgcccaacatggaagcatttctcagtgatgctcttgtgaaggtg
aagaaacgtgcccaagggtgcctggctccagagctgtgcttccaagcaatcaaagctgcc
acagagcagccatttgcagaaggagtccagaaggaacgagagctgtttaacatcctgctg
acttcaggccaggccaaagcactgcagtatgctttcttcgcagagagagcagtggagaaa
tggacaacacccagtggagcttcatggaaaagtgcttcccctcagcccatccgcaaagca
gcagtgatagggctgggaacaatgggccgaggcattgtgacttcactggttaaggccaag
atacctgtggtagccctggagcaggatctggagtatctgaacatgggaagaaaagccgtg
atgctccttttggaacgtgaggctatgaaaatggagcagggtgcccaaaccctggatttc
cataaccctgcacgactccagttctctgtggactttgatgtgctgagggatgtagatcta
gttattgaagctgtgtttgagaacatggcactaaagaaggaaatattcaacaagctatca
agaatctgcaagccagaggcctttctgtgtacaaacacgtcagccctgaatatcgatgaa
atagcttctgtcactagccgcccacagcaggtcattggcacacacttcttctctcctgct
catgtgatgaggctattagaaataatctatggccatcacacatcccccactgccattgcc
acagccatgcagctagccaaagtgatgaagaaagttggagtggtggtagggaattgtttt
gggtttgttgggaaccgaatgatgtttccatatgtacagcaggcagttttcctcttagag
gaaggaagcagaccagaagacgtagatcaggttcttgaagattttgggtttaagataggg
ccattccgaatgtctgatcttgctgggctggacgtgggctggaggtcccgaaaggaccag
ggcctcactgggccttcactagctccaggaacacctgcccgccagcggcatggctatcgc
tacagcccgctgccagaccttctgtgtgagaaaggcaggtttggccagaagaatggaaaa
ggctggtatcagtacgagaaggctgggggtaggacagccaaaccagatccatggattcac
agctttctgtctgagtacagggacagccatcaaatcaagacctgcttcatagaccaggag
gaaatcttggagcgttgtttgtttactcttatcaatgaaggatttgacatcctggctgag
ggaatagcttcaggcccagaacacctggatgtagtttatatcaatggctatggatggcca
aagcacaggggtggccccatgttctatgcttccactgttgggctccctaacattctggct
aagctacagaaatactctgagatccaccctgatgttccccagctacatcccagtgccttt
ctgaaaaagttggtggctatggggagccctcctctcagtgactggatgtcctacctacac
aggcagagcaacaagctgtga

DBGET integrated database retrieval system