KEGG   Numida meleagris (helmeted guineafowl): 110391116
Entry
110391116         CDS       T06015                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110391116 (RDH5)
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     110391116 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 110391116
NCBI-ProteinID: XP_021238525
Position
Unknown
AA seq 319 aa
MWFYLLLAALAWALGWLVRDRRTLPSIKDKHVFITGCDSGFGNLLARRLAQRGFRVLAAC
LTPQGAEGLQRGCAGHVRTTLLDVTRSDSIRRAAEWVREEVGEKGLFGLVNNAGVANPIG
PTEWMRIEDYRQVMAVNTFGAIEVTLQLLPLLKRARGRVVNTSSVLGRLSANGGGYCVSK
YCIEAFSDSLRRDMYHFGVKVSIVEPGFFKTAVTNLESIEASLRQLWERLAPETRLSYGE
EFFHKYLKVQRLIMNVICDADLGKVTRCMEHALGSCHPRTRYSAGWDAKLLWLPASYLPA
CIVDFVLATILPKPAHRVR
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtggttctatctgttgctggcggcgctggcttgggccctgggctggctggtacgggat
cgccgaaccctcccctccatcaaggacaaacacgtcttcatcaccggctgcgacagcggc
ttcggcaacctgctggcacggcggctggcccagcgcggcttccgggtgctggctgcctgc
ctgaccccgcaaggagccgaggggctgcagcgaggctgcgccgggcacgtccggaccacg
ctgctggatgtgacccgctccgacagcatccggcgagccgcggagtgggtgcgggaggag
gtgggcgagaaagggctcttcgggctggtgaacaacgcgggggtggccaaccccatcggc
cccaccgagtggatgcggatcgaggactacaggcaggtgatggccgtcaacaccttcggg
gccatcgaggtgacgctgcagctgctgcccctcctaaagcgggcgcggggccgcgtggtc
aacacctccagcgtgctcggccgcctctcagccaacggcggcggctactgcgtctccaag
tactgcatcgaggccttctccgacagcctcaggcgcgacatgtaccacttcggggtgaag
gtgagcatcgtggagcctgggttcttcaagacggctgtgaccaacctggagagcatcgaa
gcgtcgctgcggcagctctgggagcgcctggcacctgagacgcggctcagctacggcgag
gagttcttccacaagtacctgaaggtgcagcggctcatcatgaacgtcatctgcgacgcc
gacctgggcaaggtgacgcgctgcatggagcacgcgctgggctcctgccacccgcgcacc
cgctacagcgcgggctgggacgccaagctgctgtggctgcccgcctcctacctgcccgcc
tgcatcgttgacttcgtgctggccaccatcctgcccaagccagcccaccgcgtccgctag

DBGET integrated database retrieval system