KEGG   Numida meleagris (helmeted guineafowl): 110393074Help
Entry
110393074         CDS       T06015                                 

Definition
(RefSeq) epidermal retinol dehydrogenase 2-like
  KO
K15734  all-trans-retinol dehydrogenase (NAD+) [EC:1.1.1.105]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110393074
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.105  all-trans-retinol dehydrogenase (NAD+)
     110393074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-GeneID: 110393074
NCBI-ProteinID: XP_021241187
Position
2
AA seq 305 aa AA seqDB search
MNFFLEMLKVIGLSTYYMLESLVFLFVPKRKKSVSGEIVLITGAGSGIGRLLSVKFAKLG
ATLVLWDINQDGLKETVRLAEENGAVRVHSYICDCSKRQEVYRVADQVKKEVGDVSILVN
NAGIVTGKSFIESPDSLVEKTMEVNTMAHFWTYKAFLPAMIASNHGHLVSIASSAGLIGV
NRLADYCASKFAAVGFAESISLEMRALGKTGVKTTTVCPYFINTGMFDGCSTKWPRLLPI
LEPEYVAEKIMTAIRQDQAVLLLPRILYFFFAFKNILPVKVGVLLVDFVGALHFMDSFKG
RAKKD
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcttcctggagatgctcaaagtcattggactttcaacatattacatgctggag
tcactagtgtttttgtttgtgcctaaacgtaagaagagcgtgagcggtgaaatagtatta
ataacgggagcaggaagtggaattggaagactcttatccgtaaaatttgccaaacttgga
gccacactggttctttgggacattaaccaagatggactcaaggagacggttagactggct
gaagaaaatggagcagtaagagtacattcttacatctgtgactgcagcaaaaggcaggaa
gtctacagagtagcagatcaggttaaaaaagaagttggcgatgtcagcatcctagtcaac
aatgctggtattgtaactggaaagagctttattgaatctccagactcacttgtggaaaaa
actatggaagtgaacacaatggcacacttttggacatataaagccttccttccagcaatg
atagcctctaaccatggacacttggttagcattgcaagctcagcaggactgattggagtc
aatcgccttgcagattactgtgcaagtaagtttgcagccgttggttttgcagagtcaatt
agtttagagatgagagctctgggaaagactggtgttaaaaccacaactgtgtgtccttac
ttcataaacacggggatgtttgatggctgcagtaccaagtggccacgtctgcttcccatt
ttagagccagagtatgtggctgaaaagataatgactgctattcgacaagaccaagcagtt
ttgttactaccacgcattttgtatttcttctttgctttcaaaaatatcctaccagtgaaa
gtaggcgttctccttgtggactttgttggagccctccatttcatggatagcttcaaaggt
cgagcgaagaaggactga

KEGG   Numida meleagris (helmeted guineafowl): 110395001Help
Entry
110395001         CDS       T06015                                 

Definition
(RefSeq) epidermal retinol dehydrogenase 2-like
  KO
K15734  all-trans-retinol dehydrogenase (NAD+) [EC:1.1.1.105]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110395001
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.105  all-trans-retinol dehydrogenase (NAD+)
     110395001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-GeneID: 110395001
NCBI-ProteinID: XP_021244752
Position
2
AA seq 307 aa AA seqDB search
MFSFRSILKTLKFLTISIFLLFKSFIQLIFPPCKRSFAGEIVLITGAANGIGRQIALSFA
PLEATLVLWDIDEEGNKETSRLARKNGAKQVFAYYCDCSNREEVYEQADKVRREVGDVTI
LINNAGIMHVKKFLDIPDADFEKILKVNFLSQAWTCKAFLPAMIACNHGHLVSMASAAGL
MGAYKLSDYSSSKFAIIGMMEAIDSELYHAGKYGIKTTIICPYFVNTELARGIQTQNSVL
IPVYEPEYVARRIVDAIQKEKMYLFMPPALRFSGFKTLIPRKIVLLLHSYLGIYNSLDKV
IGRKKKD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcttcagaagcatcctgaagactctgaagttcctgacaatatccattttttta
ctcttcaaaagtttcatccaactcatatttcctccatgcaaaagatcttttgctggagaa
atagtgcttattactggagctgcaaatgggattggaaggcagattgccctaagttttgct
cctttagaagcaacattggttctctgggacattgatgaagaaggtaacaaagaaacaagc
agattagccagaaaaaatggagctaaacaagtgtttgcctactactgtgactgcagcaat
agggaagaggtctatgaacaggcagacaaggttagaagagaagttggggatgttactatt
ctaatcaataatgctggcataatgcatgtcaaaaagtttcttgacattccagacgccgat
tttgaaaaaatcttgaaagtcaacttcctgtctcaagcctggacttgcaaggcctttctt
cctgccatgattgcctgcaatcatggacacctcgttagcatggccagtgcagcaggactc
atgggagcctacaaattgtcagattattcttctagtaaatttgcaatcattggaatgatg
gaagccatagattcagaactgtatcatgcaggaaaatacggcattaaaaccacaatcatt
tgtccttattttgtgaatactgagttagctagaggtattcaaacccaaaactcagtttta
attcctgtttacgagccagagtatgtagccagaaggatcgtggatgcaattcaaaaggaa
aagatgtatctgtttatgcctccagctttacgctttagtggtttcaaaactttaattcct
agaaaaatagtactgctcttgcattcttacctggggatctacaacagcttggacaaggtc
atcggtcggaagaagaaagattga

DBGET integrated database retrieval system