KEGG   Numida meleagris (helmeted guineafowl): 110393478Help
Entry
110393478         CDS       T06015                                 

Gene name
ALDH5A1
Definition
(RefSeq) LOW QUALITY PROTEIN: succinate-semialdehyde dehydrogenase, mitochondrial
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00250  Alanine, aspartate and glutamate metabolism
nmel00650  Butanoate metabolism
nmel01100  Metabolic pathways
Module
nmel_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110393478 (ALDH5A1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110393478 (ALDH5A1)
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     110393478 (ALDH5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110393478
NCBI-ProteinID: XP_021242044
Position
2
AA seq 559 aa AA seqDB search
MKDVKGMGDGLTRLLAQPLRSSSSGAVRLGSARVPXASSRRAAMASLLWRRAAAARRLLL
LPPPPPGPAAARRGSWALPGALVRRGALVGGRWVETPAAFPVRDPASGDELGRVADCGEA
EARAAVRAAHEAGAAWGRLPAKERSALLRRWYELMIERKKDLATIITAENGKPLKEAEGE
ILYSASFLEWFAEEARRVYGDVIPASAKDKRILVLKQPVGVAAIITPWNFPSAMITRKVG
AALAAGCTVVVKPAEDTPLSALALGELANQAGIPAGVYNVVPCSRQQASTVGEVLCTDPL
VAKISFTGSTATGKILLKHAAGTVKRVSMELGGHAPFIVFDSADVDRAVAGALASKYRNS
GQTCVCANRFLVQKGIHDKFVEKFAKAIESELRVGSGFDAKTTQGPLINEKAVEKVERHI
NDAVSQGASVVTGGKRHSLGKNFFEPTLLSNVTTKMLCTQEETFGPLAPVIKFETEAEAI
AIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGIVSSVESPFGGIKQSGIGREG
SKYGMDEYLEIKYVCFGGL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgtgaagggcatgggtgatggtttgacgcggcttctggcccagcccctccgc
agctcctcctccggggcggtgcggttaggctcggcccgggttccgncagccagtagccgg
cgcgcagccatggcgagcctcctgtggcggcgggcggcagcggcccgccgcctcctcctc
ctcccgccgccgcctccggggccggcggcggcgcggcgcggcagctgggctctgcccggc
gccctggtccgtcgtggcgctttggtgggcggccgctgggtagagacgcccgccgcattc
cccgtgcgggacccggccagcggcgacgagctgggccgggtggccgactgcggcgaagcc
gaggcgagggcggccgtgcgggccgcgcacgaagccggcgccgcctggggccgccttccc
gctaaggagaggagcgcgctccttcgcagatggtacgagctgatgattgaaaggaaaaaa
gatctggcaacgatcataacggcggaaaacggaaaacctctgaaagaagcagaaggggaa
atcctatattctgcctcatttctggagtggtttgcagaagaagctcgccgagtttatggt
gatgtcattccagcatccgcaaaagacaaaagaatcctggtgctgaaacagccggtagga
gtggcagcaattataactccatggaatttccccagtgctatgattacccggaaggttggt
gcagctttggcagctggctgtacagtagtagtgaaacctgcagaggatacacctttatca
gcattagctcttggagagcttgcaaaccaggctggaattccagcaggagtgtataatgtt
gttccttgttcaagacagcaggcatcaactgtaggggaagttctgtgcactgatccattg
gtagccaaaatatcttttacaggctccactgcaacaggaaagatactgctgaaacatgca
gctggcactgtgaagcgagtttccatggagcttggagggcatgctccttttatagtgttt
gacagtgctgatgtggaccgtgctgttgcaggagcccttgcttctaagtatagaaactca
ggccagacgtgtgtttgtgcaaaccgtttcctggtgcaaaagggaatccatgacaaattt
gtagaaaagtttgctaaagccatcgagagcgagctacgtgttggaagtggatttgatgca
aaaactacccaggggccattaattaatgaaaaagcagtagaaaaggtagagaggcacatt
aacgatgcagtttcacaaggagcatctgttgtgactggagggaaacgtcacagcttgggg
aagaatttctttgaacctacattactgagtaatgttacaacaaaaatgctttgcacacaa
gaggagacatttggccctttagcaccagttatcaaatttgagactgaagcagaagctatt
gctatagcaaatgcagccgatgtggggctagcaggatatttctattcccaagatccagca
cagatctggagagttgcagagcagctggaagttggaatggttggagtcaatgaaggcata
gtctcttcagttgagagtcctttcggtgggataaagcagtctggcataggacgagaaggc
tccaagtatggcatggatgaatacttagaaataaagtacgtctgctttggaggcttgtag

DBGET integrated database retrieval system