KEGG   Numida meleagris (helmeted guineafowl): 110395798Help
Entry
110395798         CDS       T06015                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2
  KO
K13376  transforming growth factor beta-2
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04010  MAPK signaling pathway
nmel04060  Cytokine-cytokine receptor interaction
nmel04068  FoxO signaling pathway
nmel04110  Cell cycle
nmel04218  Cellular senescence
nmel04350  TGF-beta signaling pathway
nmel04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110395798 (TGFB2)
   04350 TGF-beta signaling pathway
    110395798 (TGFB2)
   04068 FoxO signaling pathway
    110395798 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110395798 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110395798 (TGFB2)
   04218 Cellular senescence
    110395798 (TGFB2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110395798 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nmel04052]
    110395798 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:nmel00536]
    110395798 (TGFB2)
Cytokines and growth factors [BR:nmel04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110395798 (TGFB2)
Glycosaminoglycan binding proteins [BR:nmel00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   110395798 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 110395798
NCBI-ProteinID: XP_021246345
Position
3
AA seq 412 aa AA seqDB search
MHCYLLSVFLTLDLAAVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPDEYPEP
EEVPPEVISIYNSTRDLLQEKANHRAATCERERSDEEYYAKEVYKIDMQPFYPENAIPPS
YYSLYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNSKARVSEQRIELYQVLKSKELSSPG
QRYIDSKVVKTRAEGEWLSFDVTEAVHEWLHHRDRNLGFKISLHCPCCTFVPSNNYIIPN
KSEELEARFAGIDDYTYSSGDVKALKSNRKKYSGKTPHLLLMLLPSYRLESQQPSRRKKR
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYHANFCAGACPYLWSSDTQHSR
VLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcactgctatctcctgagcgtgttcctcaccctggatctggccgccgtggctctcagc
ctgtctacctgcagcaccctcgacatggatcagttcatgcgcaagaggatcgaggcgatc
cgggggcagatcctgagcaagctgaagctcaccagccccccggacgagtaccctgagccc
gaggaggtgcccccggaggtcatctccatctacaacagcaccagggacctgctgcaggag
aaagccaaccacagagccgccacttgtgagagggagcggagcgacgaggagtactacgcc
aaagaagtttacaaaatagacatgcagcctttttaccccgaaaatgccatcccaccaagc
tattacagcctttacttcagaattgttagattcgacgtctcagcgatggagaaaaatgcg
tccaacttggtgaaggctgagttcagggtcttccgcctgcagaactcaaaggcacgggtc
tcggagcagcggatagagctgtaccaggttctgaaatccaaagaattatcatcaccagga
cagcgctacattgacagcaaagtggttaaaacaagagctgaaggagaatggttgtctttt
gatgtcactgaggctgtacatgaatggctacatcacagagacaggaaccttggatttaag
ataagcttacactgtccgtgctgcacctttgtgccttccaataattatatcatcccaaat
aaaagtgaggagcttgaagcaagatttgcaggtattgatgactacacatattccagtggt
gatgtgaaagctttaaagtccaataggaaaaaatacagtgggaagaccccacatcttctg
ctaatgttgttaccctcctacagacttgagtcgcaacagcccagtcggcggaagaagcgt
gctctagatgctgcctattgttttaggaatgtgcaggataattgctgcctgcgtccactt
tatattgacttcaagagggatcttggctggaaatggattcatgaacctaaaggatatcat
gccaatttctgtgcaggagcctgcccatatttatggagctcagatactcagcacagcaga
gtactcagcttgtataacaccataaatccagaagcttctgcctctccatgctgcgtgtcc
caagatttagaacctctcaccatcctctactacattggcaaaacacccaaaattgaacag
ctgtccaacatgattgtaaagtcttgcaaatgcagctaa

DBGET integrated database retrieval system