KEGG   Numida meleagris (helmeted guineafowl): 110397267Help
Entry
110397267         CDS       T06015                                 

Definition
(RefSeq) alcohol dehydrogenase 1-like isoform X1
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00010  Glycolysis / Gluconeogenesis
nmel00071  Fatty acid degradation
nmel00350  Tyrosine metabolism
nmel00830  Retinol metabolism
nmel00980  Metabolism of xenobiotics by cytochrome P450
nmel00982  Drug metabolism - cytochrome P450
nmel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110397267
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110397267
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110397267
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110397267
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110397267
   00982 Drug metabolism - cytochrome P450
    110397267
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     110397267
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N UDPG_MGDP_dh_N TrkA_N ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 110397267
NCBI-ProteinID: XP_021248985
Position
4
AA seq 376 aa AA seqDB search
MATAGKVIRCRAAVAWAVGKSLSVEEIEVAPPKAHEVRVKIVATGICRTDDHVLDGTFPD
LEFPVIPGHEGAGIVESTGEGVTSVKPGDKVILFGLPQCGECSFCLNPDSNYCLKSHLSE
PQNLLPDKTSRFTCKGKQIHHFLWISTFAEYTVVPEYTLAKIDAAAPLDKVCLLACGFST
GYGAAINTAKVKPGSTCAVFGLGGVGLSVVMGCKAAGASRIIAIDINKDKFAKAKEAGAT
ECINPRDFKKPVQQVLTEMTGHGVDYSFEVIGTADTLIAALASCNMNTGVCVLVGVPPAG
STVPIDPFLLLSGRTCKGTLLGGWRMRDAIPRLVASYLEKKFNSDLLITHTLPFAKINEG
FELLRAGKSIRTVLLF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggccactgctggaaaagttatccgatgcagagctgccgttgcctgggcagtgggcaaa
tcgctctctgttgaggagatagaggttgcacctccaaaggcacatgaagtgcgtgtcaag
atcgtggccacagggatctgtcgcacagatgaccacgttcttgatggtacctttccggat
ctagaattcccagtcatcccaggccatgaaggagccgggattgtggagagcactggagaa
ggggtgacctctgtgaaaccaggagacaaagtcatcctctttggacttcctcagtgtgga
gaatgcagcttctgcttgaatcctgactccaactactgtctgaaatcacacctcagcgaa
ccacaaaacctgctgcctgacaagaccagcaggttcacttgcaaagggaaacagatccac
cacttcctctggatcagtacctttgcagaatacactgttgtgcctgagtacaccctggcc
aagattgatgctgctgcaccgctggacaaagtctgcttgcttgcatgtggtttttccaca
ggctatggggctgccatcaacaccgccaaggtaaaaccgggctccacctgtgccgtcttt
ggccttggaggagttggcctctctgttgtcatgggctgcaaggcagctggagcttcccgc
atcatcgccatcgatatcaacaaggacaagtttgccaaggccaaagaggcgggagccacc
gagtgcatcaatcctcgggacttcaagaagcctgtccagcaggtgctcaccgagatgacc
ggtcacggtgtggactattcctttgaggtcatagggaccgcagataccctgattgctgcc
ctggcctcttgcaatatgaacaccggtgtctgcgtgttggttggggtaccacctgcaggt
tcaacagttcccattgatcctttccttctactcagtgggcgcacctgtaaagggactctg
cttggaggatggagaatgagagacgctatccccagattagttgccagctatttggagaag
aaatttaactctgacttgctgatcacacacacactgccgtttgctaaaatcaacgaggga
tttgaattgctacgtgcaggcaaaagcattcgcacagtgctgctcttctga

DBGET integrated database retrieval system