KEGG   Numida meleagris (helmeted guineafowl): 110401859
Entry
110401859         CDS       T06015                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
nmel  Numida meleagris (helmeted guineafowl)
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nmel01009]
    110401859 (AKAP5)
Protein phosphatases and associated proteins [BR:nmel01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     110401859 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 110401859
NCBI-ProteinID: XP_021259051
Position
6
AA seq 515 aa
MAKAAKEIQMENPSELETPSAPCPPLEEQAEKPSMLCFKKRKKSCKKGLTIKDACEGASA
ASEEKSQCLSTDQGETKASAQLRPSRGAWAALKSFTKPRRRQKSSSRKNVSSDSQVHLEM
DAEESCAQGLPRKKAGSGVKMPCVRFLRGKKKPSPSEVVEESEDSVQANEVMGILNKAIE
ELEDMAPAESCDMAESISPLPAEDIAPAEPCDKAESLSQLPAEDIHLPAEDVAPAEPCDK
AESISHLPAEDQGTSVEGANADRKREPLAEPRPDVDEHTECITQSGITSLEPVNEPVQEN
LPEGSPHHSAAQVEEREVAPEALVSIDQPNSTLEITEVQERATICKELPERDELERNADL
PEVCKSEETTMDFSPSVSKDDATSVQSSSGHQEKPEVNIGTGVGIVITVTEVVDSDDADS
DQAYEPSPVLHHNKQKGNKKSSGSFDFGQKESPGAGSGAVAEEKSLGDQGHRTSDQYELL
LIETASSLVKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggcaaaggcagctaaggaaatacaaatggagaacccaagcgagctggagactcctagt
gctccatgccccccactggaagaacaggcagaaaaaccctccatgctctgtttcaagaag
cggaagaagtcctgtaagaagggactgacaattaaggatgcgtgtgagggagcttctgca
gcctcagaggagaaaagtcaatgcctcagcacagaccaaggggagacaaaagcttctgct
caattgcgaccctccagaggagcttgggcagctctcaaaagtttcacaaagcctcggaga
aggcagaaatcctcttcacggaagaatgtgtcctccgattcccaggtgcatctggagatg
gatgcagaggagagctgtgcacaaggtctcccaaggaaaaaggctggctcaggggtgaag
atgccctgtgtgcgcttcttgagaggcaagaaaaagcccagcccctcagaggtggtggaa
gagtcggaggacagtgtccaagcaaatgaagtaatgggcattttgaataaagccattgaa
gagctggaggacatggccccagcagagtcttgtgacatggctgagtccatcagcccgctc
cctgcagaggacatagccccagcagagccctgtgacaaggccgagtccctcagccagctc
cctgcagaggacatccatctccctgcagaggacgtggccccagcagagccctgtgacaag
gccgagtccatcagccatctccctgcagaagaccagggcacgtcggtggaaggtgccaat
gccgataggaagagagagcccttggcagagcccaggccagatgtggatgaacacacagag
tgcatcactcagtcaggaataaccagtttggagcctgttaatgagccagtgcaggaaaac
ttgcctgaggggagtccgcaccactctgcagcccaagtggaagagagggaagtcgctcct
gaagcactggtttccatagatcaaccaaacagcaccctggaaatcactgaggtgcaggaa
agagccactatctgcaaggaacttcctgaaagagatgagttggaaaggaacgctgatctt
cctgaggtgtgcaaatctgaggagaccacaatggatttcagtccatcagtgtctaaagat
gatgcaacaagtgtgcagagcagctccggccatcaggagaaaccagaagtcaacattggc
actggtgttggcattgtcatcaccgtcaccgaagtcgtggactctgatgacgccgattct
gatcaagcctatgagccatccccagttttacaccacaataagcaaaaaggaaataaaaaa
tccagtgggagctttgattttggtcaaaaagagagccctggggctggcagtggtgctgtg
gcagaagagaaaagtctgggtgaccaggggcacaggacttcagatcagtacgagttgctc
ctcatagaaacggcgtcttccctcgtgaaggcggccatccagtcatccatagagcagctg
gtcaatgagatggctctggaacagaataaacacaacagttttctgtga

DBGET integrated database retrieval system