KEGG   Numida meleagris (helmeted guineafowl): 110402806Help
Entry
110402806         CDS       T06015                                 

Gene name
HLCS
Definition
(RefSeq) biotin--protein ligase isoform X1
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00780  Biotin metabolism
nmel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    110402806 (HLCS)
Enzymes [BR:nmel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     110402806 (HLCS)
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     110402806 (HLCS)
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     110402806 (HLCS)
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     110402806 (HLCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_N BPL_C ABC_transp_aux DUF1323
Motif
Other DBs
NCBI-GeneID: 110402806
NCBI-ProteinID: XP_021260945
Position
1
AA seq 897 aa AA seqDB search
MLITLCYLYLWARWGPCSAALIRRTVRRLHRSRCSFIFCCSAGPAPPPAHPPHPPRRSAP
LEERVCLRIGNKVFFTDETQLLDDLNRWSLLLISPFIYPDKLLETEHIAFVTESISAQAD
NLQKLPVSSKEIVKWSDYCLPLAYKPGEPYKLIAEASVDNFSNLGIAFMEDRLQMDNGMV
PYKIVSVHLQETTLSELKQVTPSMKDRSVSVTQMNEVIPATSGTTVKTQLGVAESAGQGD
TEAKEEKSKLGKENEHEDESSSLSDKETGFGEHHHLHLSSCRECLQLENSTIESVRFASV
EDIPELPDDCSSKLEENGDCLATGIKRVNLAGKPPNILIYVGSGTAKVDFEQVKSIIQEC
IDTDSYTIYQLHEEQVLKAPWIDNSLLLIIATEKPISEKNQKQFMKFLSKGGKILGLSSS
FTFDDIQIKRKDKLKKTVHELLVSKPDSTEIKLNLLISGCIFEVGMKEGSNKVKPLSCLN
NADKDIVIVHLPYGDNGGEAILSQVHLELDANSVDIQTEEDFNLLKMSNPKRYEVLKEIL
ISLGLSCELSEIPMLTPIYLLSSDEEIHLAFLKWLEENVNVEGLIESSKVSLKFVSSCES
KMGITPSLMSVITKMGSFSSEHFSLETYQQNLQTKKLGKILFFTEVTTTTMNLLDGLMFK
LPEEMGLIAVAVRQTQGKGRGGNVWLSPVGCALSTLHITIPLHSNLGQRIPFIQHLVSLA
VVESVRSIPGYEDIDLRVKWPNDIYYSDLMKLGGVLVTSTLIETTFHILIGFGFNVNNSN
PTICINDLITKFNKEEGTNLKALTADCLIARTVTVLERLIDIFQEKGPNGVLPRYYKYWV
HSGKQVRLHNEEGPLAWIVGIDDYGFLQVHEEGKGVESVHPDGNSFDMLKNLIIPKH
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcacgctctgctacctctacctatgggcgcgctgggggccttgttcggccgcg
ctcatccgtcgcactgtgcgccgcctccaccgctcccgctgctccttcatcttctgttgc
tccgccggccctgcgccgcctccggctcatccgccgcatccgccgcgcaggtcggcgccg
cttgaggagcgcgtctgcctcaggataggaaacaaagtcttcttcacggacgagacgcag
ctcctcgatgatttaaacagatggagtctacttctcatttctccttttatttatcctgat
aagttactcgaaacagaacatatagcttttgtgacagaaagcatttcagctcaggcagac
aacttgcagaaattacctgtctcttcaaaagagattgtgaagtggtctgactattgttta
ccgttggcctataaacctggggaaccttataaattaattgctgaagcaagtgtagataat
ttcagtaaccttggaatagcattcatggaagacaggcttcagatggataatggaatggtt
ccatacaagattgtttctgtccatttacaagaaactactctgagtgagttaaaacaggtg
acaccatctatgaaagataggagtgtaagcgttacacagatgaatgaagtaattcctgct
acttctgggactactgttaaaacacaattgggagtagctgagtctgcaggacaaggtgat
acagaggcaaaagaagagaaatctaagctagggaaagaaaatgagcatgaagatgaatcc
agcagcctatctgacaaagagacaggttttggagaacatcatcacttgcatctttccagc
tgtcgtgaatgtctgcaacttgaaaacagcactattgaatcggtcagatttgcctctgtg
gaagacattccagaacttccagacgattgcagtagcaaactggaagagaatggtgattgt
ttagcaacaggaataaagagagtaaaccttgctggaaagcccccgaatatattgatttat
gttggctctggaactgccaaagtggactttgagcaagtaaaatcaatcattcaggaatgc
attgatacagacagctacaccatctaccagctgcatgaggaacaagttctgaaagctcca
tggattgataattcactactgttgatcattgccacagagaagcctatttctgagaagaac
caaaaacagtttatgaagtttttatctaaaggtggaaagattctagggttgtcttcctct
tttacatttgatgatatacaaataaagagaaaagacaaactcaagaaaactgttcatgaa
ttactggtctctaaaccagacagtactgaaattaaattaaatcttttgatcagtggctgt
atttttgaggtagggatgaaggaagggagcaacaaagtgaagccattgagttgcttaaat
aatgctgacaaagatatagttattgttcatctgccttatggagacaatggaggagaagcc
attctttctcaggtgcatttggaactggatgccaattctgtggatatccaaactgaagag
gattttaatttgcttaagatgagcaatcccaagagatacgaagttctcaaggagattctg
atatctcttggcctgagttgtgaattaagtgaaattcctatgttaacgccaatttacctt
ctctcttctgatgaggaaattcatcttgcatttttgaaatggcttgaggaaaatgtaaat
gttgaaggattaatagaatccagcaaagtgtctcttaaatttgtttcatcttgtgaatcg
aaaatggggataactccatctctcatgtcagtcatcacgaagatgggaagcttctcatca
gaacatttcagcctggagacatatcaacagaatctgcaaacaaagaaacttggaaagatt
cttttctttactgaagttaccaccacaacaatgaatcttcttgatgggttaatgttcaag
ttgcctgaggagatgggtttaatagcagttgctgttcgacaaacacaagggaaaggtcgt
ggcggaaatgtttggctcagtcccgtgggctgtgcactatccactttacatatcacaatt
cctctacattccaacctgggccagagaattccttttattcaacacctagtgtccttggca
gtggtagagtcagttagatcaataccaggatatgaggatattgacctgcgagtgaaatgg
ccaaatgatatttattacagtgatcttatgaagcttggtggagttctggtaacctctaca
cttattgaaacaacatttcatatacttattggctttggatttaatgtgaataacagcaac
cctaccatatgcatcaatgacctcattacaaaatttaataaggaagaggggacaaatctg
aaggctttaactgcagactgccttattgcaagaactgtaactgtgctagagaggcttata
gacatttttcaggagaaagggcccaatggagttcttcctcgttactacaagtactgggta
cacagtggcaagcaggttcgtctccacaatgaggagggcccattggcatggatagtcggg
attgatgattatggattccttcaagttcatgaagaaggcaaaggtgtagagtctgtgcat
ccagacggcaactctttcgacatgctgaaaaacctcataatcccaaagcattaa

DBGET integrated database retrieval system