KEGG   Numida meleagris (helmeted guineafowl): 110403364Help
Entry
110403364         CDS       T06015                                 

Gene name
NRK
Definition
(RefSeq) nik-related protein kinase isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110403364 (NRK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nmel01001]
    110403364 (NRK)
Enzymes [BR:nmel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110403364 (NRK)
Protein kinases [BR:nmel01001]
 Serine/threonine kinases: STE group
  STE20 family
   110403364 (NRK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 110403364
NCBI-ProteinID: XP_021262174
Position
8
AA seq 1284 aa AA seqDB search
MEIGVRIEETFLEMSDGSQRAGSVPKGWRRPPKVQFLFYFFFFLLSSKKGEAGGLGTPDV
WLDLSNEDPAGIFELVQVVGNGTYGQVYKGRHVKTGQLAAIKVMNVTENEEEEIKLEINM
LKKYSHHRNIATYYGAFVKKSPAGQDDQLWLVMEYCGAGSVTDLVKKTKGNCFKEDWIAY
ICREVLRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTIGRRNTFIGTP
YWMAPEVIACEENPDSTYDYRSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPK
LKSRKWSKKFLNFVESCLVKNYLHRPSTETLLKHSFIRDMQNERQVRIMLKDHLDRTRKK
KGEKEETDYDYSGSEEEDDELNEDEGEPSSIVNLPGESTLRREFLRLQQENKNRSDPQRQ
QQQLKDQEKYKKQLLTERQKRIEQQKEQRRRLEDHQRREQELRRQQECEQRWPETKDVQR
KEERCKEDRRAVEDDEWFIGDGQRKSEKKQKKVEDVQHNKKGHRTLPKDQTQLLSLQHDH
KQKKKEPSKSSNSAAHLPSSNATKEAEDRRKRSDGIQPALQWPAALGHDAMPQARVGSGS
SSSPCTPAMQRAVLVQCDSFQASKDAYHSSSLSDMVTTPLSPGQDDVFWSGTRSEEQPPK
VPERTTSKFYSRDQPGQQGCHSSNSHQLSPGGHALKLSTSSSSTAGNKQWEMASHQSSRS
TSGNPGPAKGENALSQNHMQLHKKPEKVSHPGQMASPCSFAKGKDGANLFSKAADYSSSS
DEVGSSDEDDTNHMRQLLSSRVADFSRTRVPDGIELKPQSTATEQKDQILGKQISSTQEG
LWSINNQNYLLPDLLQQSQISSAAVSPPKVPLTNQEPQNKPVSKTPSTESTPSKSSTSST
TSFTSFIDPRLLPITPPTSPVGPPCGSPSSAKPEPVRRENARKGSVVNVNPTNIRPQSDS
PEIRKYKKKFNSEVLCAALWGVNLLVGTENGLWLLDRSGQGRVYSLITRRRFQQMDVLEG
LNVLITISGKKNKLRVYYLSWLRNKILRNDPEVEKRQGWVSVGDLEGCVHYKVVKYERIK
FLVIALKSSVEVYAWAPKPYHKFMAFKSFTSLHHKPLSVDLTVENGQRLKVIYGSLVGFH
AIDVDSGSVYDLYLPTHIQGTIRPHAIIILPNTSGMELLLAYEDEGIYIDIYGHFTKETV
LQWGEMPASVAYLQSNQVMGWGEKAIELRSVETGNLEGVFMHKKAQKLKFLCERNDKVFF
ASVQSGGSSQIYFMTLGQNVLFNW
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
atggaaattggagtgagaatagaggagactttcctggagatgtctgatgggtcgcagagg
gcaggttctgttccgaagggctggaggaggcctcctaaagtacagttcctcttctacttt
tttttttttcttctttcctctaagaaaggagaagcagggggcttgggaactccagatgtg
tggctggacttgagcaatgaggaccctgcgggaatatttgaactggtgcaggttgttggc
aatgggacgtatggacaagtctataagggccgccatgttaagactgggcagctagcagca
atcaaagtgatgaatgttactgagaatgaagaggaggaaatcaagttggagataaatatg
ctaaagaaatattcccatcatcggaatattgctacgtattatggtgcgtttgtgaagaaa
agccctgcaggccaagatgatcagctctggctggtgatggagtactgtggtgctggctct
gtcactgatctggtgaagaagacaaaagggaactgttttaaggaagactggattgcatac
atctgcagagaggttctcaggggcttggcacatcttcatgctcatcatgtcatccatcga
gatattaaaggacagaatgttcttctcacagaaaatgcagaagtaaaactggtggatttt
ggtgtaagcgcccaactggatagaactattgggagaagaaacacatttattggaacgcca
tattggatggcacctgaagtcattgcttgtgaggagaacccagattctacctatgattac
agaagtgacctctggtctttgggaatcactgctattgaaatggctgaaggagctcctccc
ctgtgtgacatgcatcctatgagagcgctcttcctcattccgcggaacccgcccccaaag
ctgaaatccagaaaatggtcaaagaagttccttaattttgttgaaagctgccttgtaaaa
aattatttgcatcgtccgtccactgaaaccttgcttaagcactcctttatccgagacatg
cagaatgaacggcaagtgcgcatcatgctgaaggaccacctggataggacgaggaagaag
aaaggagaaaaggaagaaacggactatgattacagtggaagtgaggaggaagatgatgag
ctgaatgaagatgaaggagaaccaagctccatagttaatcttcctggggagtcaactctc
cgtcgtgagtttctgaggctgcagcaggagaacaaaaaccgttctgaccctcagcgccag
cagcagcagctgaaggaccaggagaaatacaagaagcagctgctgacagagcggcagaaa
cgcatcgagcagcagaaagagcagaggaggaggctggaggatcatcagaggcgagagcaa
gaactccgaaggcagcaggagtgtgaacagaggtggccagagactaaggatgttcagagg
aaagaggagaggtgtaaggaagacagaagggctgtggaagatgatgaatggttcatagga
gatgggcagaggaaatcagaaaagaagcagaaaaaggtggaagacgtgcagcacaacaag
aaggggcatcgaactctccccaaagatcagacgcagctgctgtctctccagcatgaccac
aagcagaagaagaaggagccttccaagagttcaaattcagcagcacatcttccatcaagc
aatgcaaccaaagaggccgaggaccgaagaaagagaagtgatggcatccagcctgccctg
cagtggcctgcggcgctggggcacgacgccatgccacaggcaagggtgggctctggcagc
agctccagcccctgcacccctgcgatgcagagagccgtcttagtgcagtgtgacagtttc
caggccagtaaagatgcgtaccacagcagctcgctgtcggacatggtgaccacaccgctc
agccctggacaggatgacgtattctggagtgggactcgaagtgaagagcagcccccaaag
gttccagaaaggacaacctccaaattttacagcagggatcaacctggccagcagggatgc
cattcaagtaacagccatcagctgtccccagggggacacgctctgaagctcagcaccagc
agcagcagcactgctggcaacaagcagtgggagatggcatctcatcagagcagccgatcc
acctcagggaatccaggaccagccaagggagagaacgctttgtcacagaaccacatgcag
ctgcataagaagcctgaaaaagtttctcatccgggccagatggcaagcccatgttccttt
gccaaggggaaggatggcgccaatttgttctcaaaagcagcagactattcctcatcaagt
gacgaagtcggcagcagtgacgaagatgacacgaaccacatgaggcaactgctgagcagc
agagtggcagatttctcaaggacgagagttccagatgggattgaactgaaaccccaaagc
accgccacagaacagaaggatcagattttagggaaacaaatttctagcacccaagaaggc
ctctggagcataaacaatcagaactatctcctgccagatcttctccagcaaagccaaatt
tccagtgccgctgtgagcccaccaaaagtgccactgactaaccaggaacctcagaacaaa
cctgtgagtaagaccccatccactgaaagtacaccttcaaagagcagcacatcatctaca
acatcgttcacttcgttcatagatcctcgacttctgccaatcacccctcctaccagtcca
gtgggacctccctgtggttctccatctagtgcaaaaccggagcctgtcaggagagagaat
gcaaggaagggctctgttgtcaatgttaacccaacaaacatccgcccacagagcgacagt
ccagaaattcgtaaatacaagaagaaattcaactcagaggtcctttgtgctgctttgtgg
ggagtaaatttactggtgggaacagagaacggattgtggctgctggacagaagcgggcaa
ggaagagtttattcactgattacaaggagacgattccagcaaatggatgttctggaagga
ctcaatgtgctaattactatatcagggaagaagaataagttaagagtctattacctgtca
tggctgagaaataagattttgcgcaatgatccagaggtggagaagcggcaaggctgggtg
tctgtgggtgacctggaaggctgcgtacactacaaagttgtaaaatatgagagaatcaaa
ttccttgtaattgctttgaaaagctcagtggaggtttatgcttgggctccaaagccttat
cacaaattcatggcttttaagtcctttacctcacttcatcacaaaccactgtcagttgac
ctgactgttgaaaatgggcaaagattaaaagtgatctacggctctctagtaggctttcac
gccatcgatgtggactctggatctgtgtatgacctctaccttccaacacacatccaggga
actattcgcccacatgccatcatcatcctcccgaataccagtggaatggaacttctactc
gcctacgaagatgaaggcatctacattgatatatatgggcatttcacaaaggaaacagtt
ttgcagtggggagaaatgccagcatctgtagcttaccttcaatctaatcaggtcatgggc
tggggagagaaggcgattgaactgcgctctgtggaaacaggaaatctggaaggagtattt
atgcacaagaaagcgcagaagctgaaatttctatgtgaaagaaatgacaaggtattcttc
gcatctgtacaatcaggaggcagcagtcaaatttactttatgactcttggtcaaaacgta
ctgttcaactggtaa

DBGET integrated database retrieval system