KEGG   Numida meleagris (helmeted guineafowl): 110404203Help
Entry
110404203         CDS       T06015                                 

Definition
(RefSeq) arylamine N-acetyltransferase, liver isozyme
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00232  Caffeine metabolism
nmel00983  Drug metabolism - other enzymes
nmel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    110404203
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    110404203
Enzymes [BR:nmel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     110404203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 110404203
NCBI-ProteinID: XP_021263938
Position
10
AA seq 296 aa AA seqDB search
MNIQEYFSRISFDGSHKDADLQTLTAIFQHHIQAIPFENLSMHCGETIDLDLQSTYNKIV
KKKRGGWCMETNYLLFWALKEMGYDVCVLGGNSYDPAKRAYIAHINHILLKVVIEGSSYI
VDAGFGGGPYQTWQPMLLISGKDQPQIPGIFRFTEDSGIWYLEKVKRKHYIPEGSVPLTD
TPGMGNIRKLYSFTLEPKHIDDFQELNTYLQVSPDNILQKKSICSLQTTEGFYALVGWTF
TEMKYNYKEDTDLLQTTTLTDEEVEKTLKDKFNIVLENKLIPVNVRGLPPNLVDTI
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcaagagtatttctcaagaatttcttttgatggctcccataaggatgcagac
ttgcaaaccttaacagccatcttccagcatcacatccaggcaattccttttgaaaacctc
agcatgcattgtggagagaccattgacctggatttacaatctacttacaataaaattgtg
aaaaagaaacgtggtggatggtgcatggaaacaaactacctcttattttgggctttgaaa
gaaatggggtatgatgtctgtgtgcttggaggaaatagttatgacccagcaaagagggcg
tacattgctcatataaatcacatcctactgaaggttgtgatcgagggaagttcctacata
gtagatgctggttttggtggtggtccctaccaaacatggcagccaatgttgctgatttct
gggaaggatcaaccccagattcctggcatcttccgcttcacggaagacagtggcatctgg
tacttggagaaggtcaaaaggaagcattatataccagagggaagtgtccctctcactgat
actccaggaatgggcaatatcagaaaactatattcattcactcttgagccaaaacacata
gatgacttccaggagctaaacacatacctacaagtgtctccggataacatacttcagaag
aagtcaatctgcagtctccagaccactgaagggttttatgccttagttggatggaccttc
actgagatgaagtacaactacaaggaggacacagacctgctgcagaccacaacccttaca
gatgaagaggttgagaagactctgaaagacaaattcaacatagtgttagagaacaaattg
ataccagtaaacgtccgtggcttgccaccaaacctggtggatacaatataa

DBGET integrated database retrieval system