KEGG   Numida meleagris (helmeted guineafowl): 110404969Help
Entry
110404969         CDS       T06015                                 

Gene name
GPX1
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00480  Glutathione metabolism
nmel00590  Arachidonic acid metabolism
nmel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110404969 (GPX1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110404969 (GPX1)
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     110404969 (GPX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx Redoxin
Motif
Other DBs
NCBI-GeneID: 110404969
NCBI-ProteinID: XP_021265462
Position
11
AA seq 195 aa AA seqDB search
MAASGLLGISARPLGAAEPLALGSLRGKVLLVVNVASLUGTTTRDFLQLNELQQRYGPRG
LRVLGFPCNQFGHQENATNEEILRSLEYVRPGNGFKPNFTMFEKCEVNGKGAHPLFAFLR
EALPFPHDDPSALMTNPQYIIWSPVCRNDISWNFEKFLVGPDGVPFRRYSRHFETIKLRD
DIELLLQKVPKEAPE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcggcatcggggctgttggggatctcggcgcggccgctgggagcggcggagccgctg
gcgctgggctcgctgcggggcaaagtgctgctggtggtcaacgtggcctcgctctgaggc
accaccacgcgcgacttcctgcagctcaacgagctgcagcagcgctacgggccccgcggg
ctgcgcgtgctcggcttcccctgcaaccagttcgggcaccaggagaacgccaccaacgag
gagatcctgcgctcgctggagtacgtgcggcccggcaacggcttcaagcccaacttcacc
atgttcgagaagtgcgaggtgaacgggaagggcgcgcacccgctgttcgccttcctgaga
gaggcgctgcccttcccgcacgacgacccgtcggcgctgatgaccaacccgcagtacatc
atctggtcgccggtgtgccgcaacgacatctcctggaacttcgagaagttcctggtgggc
cccgacggcgtgcccttccgccgctacagccggcacttcgagaccatcaagctgcgggac
gacatcgagctgctgctccagaaggtgcccaaggaggctccggaataa

DBGET integrated database retrieval system