KEGG   Numida meleagris (helmeted guineafowl): 110405784Help
Entry
110405784         CDS       T06015                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00250  Alanine, aspartate and glutamate metabolism
nmel00280  Valine, leucine and isoleucine degradation
nmel00410  beta-Alanine metabolism
nmel00640  Propanoate metabolism
nmel00650  Butanoate metabolism
nmel01100  Metabolic pathways
Module
nmel_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    110405784 (ABAT)
   00650 Butanoate metabolism
    110405784 (ABAT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110405784 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    110405784 (ABAT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110405784 (ABAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nmel01007]
    110405784 (ABAT)
Enzymes [BR:nmel01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     110405784 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     110405784 (ABAT)
Amino acid related enzymes [BR:nmel01007]
 Aminotransferase (transaminase)
  Class III
   110405784 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 110405784
NCBI-ProteinID: XP_021267123
Position
13
AA seq 500 aa AA seqDB search
MASMLLSRQLSCCLRQNSRLLTFGHRYISQAAAKIDVDFDYDGPLMKTEVPGPRSRELMK
QLNGIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPSLIKLLQQPQ
NLSTFINRPALGILPPENFSERLKESLLSVAPKGLPQVMTMACGSCSNENAFKLIFMWYR
NKERGRNNVTKEELESCMINQPPGCPDYAMLSFMGGFHGRTFGCLATTHTKAIHKLDIPS
LDWPIAPFPRLKYPLEDFVKENQQEEARCLEEVEDLIVKYRKKKKIVAGIIIEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVVTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPAKNLLLAEVIRVIKREDLINNAAHAGKALLTGLL
DLQARYPHLISRVRGRGTFCSFDTPNDATRNKLITIARNKGVVLGGCGDRSIRFRPTLIF
KDHHAHLFLNIFSDILANFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgatgctgcttagtcgacagctgagctgctgtctgcggcagaactccaggctg
ctcacatttggacacagatatatcagtcaagctgcagctaaaattgatgtggattttgat
tatgatggacctctaatgaagacagaagttcctggaccacgatctcgggaattaatgaag
cagctgaatggaattcagaatgccgaagctgtgcacttcttctgcaattacgaagagagc
cgagggaactacctcgtagatgtcgatggcaatcgcatgctggatctctactctcagatt
tcatccatcccaataggttacagccatccgtctctgataaagcttctccagcaacctcag
aacctgagcacttttatcaacagacccgccctagggatattacctccagagaacttttca
gaaagactgaaggaatccttgttatcagtggctcccaagggtctgccacaggtgatgacc
atggcttgtggatcctgctcaaatgaaaatgcatttaaattaatatttatgtggtacaga
aacaaggagaggggccgtaataatgtcacaaaagaggagctggaatcgtgcatgattaac
cagccccccggctgccccgactacgccatgctctccttcatgggtggcttccatggaagg
accttcggttgcttagctacaactcacactaaagcaattcacaaactggacatcccatcg
ctggactggcctattgctccatttccaagactgaagtaccctttggaagactttgtgaaa
gagaatcaacaggaagaagcccgctgtttagaggaggtggaagatctgattgtgaaatac
aggaaaaagaagaagattgtggctggaatcattatagaaccaatacagtcagagggtggg
gacaaccacgcctcagatgacttctttagaaagctacgagacattgccagaaagcatggc
tgtgcattcttggtggatgaggtgcagacaggaggtggctgcacaggaaaattctgggca
cacgagcactggggcctggatgatccagctgatgtggtaacatttagtaagaagatgatg
acaggaggatttttccacaaagaggagttcaggccaaatgctccctatcggatttttaac
acctggcttggagatccagccaagaaccttctgcttgctgaagtcattagggttattaaa
agagaagatcttataaacaacgcagcccatgcaggaaaagcactactgactgggctgctg
gatttacaggctcgctacccccatcttatcagcagagtgagaggaagaggaaccttctgt
tcgtttgacactccaaatgatgcgactagaaacaagctaattacaatagcgagaaacaaa
ggtgttgtgctgggaggctgtggggacaggtcgatccgctttcgtccgacgctgatcttc
aaggatcaccacgcgcacctcttcctgaacatcttcagtgacatcttagcaaatttcaag
taa

DBGET integrated database retrieval system