KEGG   Numida meleagris (helmeted guineafowl): 110406845
Entry
110406845         CDS       T06015                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nmel01002]
    110406845 (ADAMTS13)
Enzymes [BR:nmel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     110406845 (ADAMTS13)
Peptidases and inhibitors [BR:nmel01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   110406845 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin ADAM_spacer1 TSP1_spondin Reprolysin_4 Reprolysin_5 Pep_M12B_propep Reprolysin_3 TSP1_CCN Reprolysin_2 Peptidase_M10 Peptidase_M66
Other DBs
NCBI-GeneID: 110406845
NCBI-ProteinID: XP_021269518
Position
16
AA seq 1461 aa
MISSLMIRALVMFPLGFCWPSVLQEKFLRALDAEDVFSYFGTSSASDVPEFVVAQPNCPC
KEEQIGLCRIQHCSIEAWGEVYAFEFLEDHTLLSSSFVINQVMNSSFSLIKKFSGNCFAG
GNLLTPPGAECRVTYCEGQLQGVIVTDEEKIHIRPVRSKDVALLKELGFSSPHILFRSAE
KKPARAGRFASRLRKRADGTVKHLELMVVAGPDVYSYHKEDTERYILANLNIGAELLRDA
SLGAHLRVHLMQMLVLREPEVDVNITSNITSSLISVCEWSKKVNPQNDSDPHHADIVLYV
TRFDLELPDGNKELRGVTQLGGVCSSFWSCVITQDTGFDLGVTIAHEIGHSLGIPHDGEG
NQCSSSGYIMGSAGNHNSVDLVWSQCSREEFLAFVSTGQTNCLNDLPDMDGSIPGWKPGV
YYGADEQCKIAFGSVATACTFADSNVDICKVLSCHVQPGDKSSCTRLLVPLLDGTECGIN
KWCSKGQCSSLKELDPMAVVHGQWSSWSPLSSCSRSCGGGVRIRQRFCNNPRPAFGGKEC
QGAGIQVEMCNTQACLMTQLEFMAEQCAATNLKPLYLTVGVPSFYTWTSAVGFAKGDMQC
KHMCRAIEEEFMVSREDSFIDGTRCEPDNSEHGTFNLCVAGSCRAFGCDGQMDSKKIMDS
CKVCGGDNTTCMQVSGSYTEGKAKEYVTFLSLPHNTTLVHVINQRPLFTHLAVKVKGEYV
VAGKGKISLNVTYPSLLEDRQIKYEVFLTKDNLPSLEEIHVDGPTQEEIEIQVYRRYAKE
YGDATNPDITFSYFVPKENLTYRWIPQQGPCSVTCGGGTRPVNHVCFDQTKNEITENQLC
LELLQPLPGYEPCAVEPCLYRWKISQTDECSAVCGSGVAQQNLTCVQFHNGLETVVDDSL
CPAQEKPPSTVPCVVNICPLGWDKEEDMDLLQAPESLGHIQLENQSVYVWSPLAGECSVS
CGRGKTQIQYVCVAFDTKEKTQEENCHPVAKPESRMEDCNLSPCPPRWHYKMGSCSVSCG
GGVMQKVLYCARETREKEEEIVADTQCDGLPRPEEQEPCNLEPCPPRWKVTPGGPCSSSC
GLGLSVQLVTCVQIHQGKEILLEQHLCPVSEKPLTTIPCVVRMCSYEWSFSEWTECSTSC
GNGVQTRHDFCLNRLTHKHVNPIFCRRFPKAIVLRGCYAGPCPEQEVGTRLHGAELQAVT
PATHLMTVANAKGARYKVLDLPPSAVPAVPQEQAKETSEGVCGKLFLNTSGVINMTGVES
SDCTVAIGRPLGEEITINVLESSLNCSAGEVVLFSGRMMWRTGCRKLVLSLINSRTNTLI
VKQRVLLPGNGVVLQYNSRNATKKYYQECDKQLFGPRGEIVNPMQSPGQRQEVVCRTFIN
VAPQHRVAIRGLYVDQSHESNQTHFNYILIRDVSTMKTMVFRGKQQFFWQSTGSQAEIEF
HENVKDHQSSFWAEYHAAEPK
NT seq 4386 nt   +upstreamnt  +downstreamnt
atgatcagcagtctgatgatccgagcgctcgtgatgttccctctggggttttgctggcca
tccgtcctccaagagaaatttctcagagctttggatgcagaagatgttttctcttatttt
ggaaccagctcagcctctgatgtacccgagtttgttgttgctcagccaaattgcccttgt
aaagaagagcagattgggctatgtcggatccagcactgctctattgaggcttggggagaa
gtgtacgcctttgaatttctggaggaccatactcttctttcttcttcctttgtgatcaat
caagtcatgaactcttcctttagcttaataaagaaattctcaggcaactgctttgcaggt
ggaaatctattgacacctcctggggctgagtgtagagtcacttactgtgaagggcagctg
caaggagtcattgttacagatgaagaaaagattcatatcaggcctgtcagaagcaaagat
gtggccctgctgaaggagcttggcttctccagtccccacattctcttcagaagtgctgaa
aaaaaaccagcaagagcagggcgctttgcttctcgcctacggaagagggctgatggaact
gtcaaacatctggagctgatggttgtagcaggtcctgatgtttactcgtaccacaaagag
gacacggagcgatatattcttgccaacctcaacattggggcagaactgctgcgagatgcc
tcactgggtgctcatttaagggttcatttgatgcaaatgcttgttttgagagagcctgag
gtggatgtaaacatcacatcaaatatcacctcctcgctgatcagtgtttgtgagtggagc
aagaaggtcaacccccagaatgactctgatccccaccatgctgacattgtcctgtatgtg
accaggtttgacctggagttacctgatgggaacaaggagctacgtggagtgactcagtta
ggtggagtctgctcctccttctggagctgtgttattactcaggacaccggctttgacttg
ggagtcaccatagcccatgagattggtcacagtcttggcatcccccatgatggtgagggg
aatcagtgcagcagcagtggttacatcatgggttcagcaggaaaccacaatagtgttgac
cttgtctggtcacagtgtagccgagaagaattcctggcctttgtcagcacaggccaaaca
aactgcttaaatgacctgccggacatggacggcagcatccctggatggaagcctggcgtg
tactatggagcagatgagcaatgtaaaatagccttcgggagtgttgcaactgcgtgcacc
tttgctgacagcaatgttgatatatgtaaagttctctcatgccatgtacaaccaggagac
aaatccagctgtactcggcttcttgttcccctcttggatggtactgagtgtggcatcaat
aagtggtgctccaagggacagtgcagctctctgaaagaactggaccccatggctgtagtc
catgggcagtggtccagctggagcccgttgtcctcctgctcccgcagctgtggaggtgga
gttcggataaggcagcggttctgtaacaaccccaggcctgcttttggagggaaggagtgc
cagggtgccggcattcaagtggagatgtgcaatactcaggcctgtttgatgacccagctt
gagtttatggctgagcagtgtgcagcaacaaatttaaagccactgtatctcactgtagga
gtgccatccttttacacctggacttctgctgttggctttgccaaaggggacatgcagtgc
aagcacatgtgcagagccattgaagaagaattcatggtaagccgtgaggacagtttcata
gatggaaccagatgtgagcctgataactctgagcatgggactttcaatctgtgcgtagcg
ggaagctgcagagcattcgggtgtgatggccagatggactccaagaagataatggactct
tgcaaggtctgtgggggtgataataccacttgcatgcaagtgagtggatcttacacagaa
ggaaaagctaaagagtatgttacatttttgtccctgcctcataacaccaccctagtccat
gttatcaatcagagaccactcttcacacatttggctgtgaaggttaaaggtgaatatgtg
gttgctggaaagggaaaaatctcattgaatgtcacctatccgtcacttctggaggacaga
cagatcaaatatgaagtatttctcaccaaggacaacctgccaagcctggaggaaatccat
gtggatgggccaacccaagaagaaattgaaatacaggtttatagaaggtatgcaaaagaa
tatggcgatgccaccaacccagacatcaccttcagctactttgtgccaaaagagaatctg
acgtataggtggattcctcagcaggggccatgttcagtgacctgtggaggaggtacacga
ccagtgaaccatgtgtgctttgatcagacaaagaatgaaataacagaaaatcagctgtgt
ctggaactcctacaaccccttccagggtatgaaccctgtgccgtggaaccatgcctgtac
aggtggaagatatctcagacagatgaatgttctgctgtctgtggaagcggtgttgcccag
cagaatctgacctgtgttcagtttcataatggattggagactgttgtggatgacagctta
tgtcctgcacaagaaaaacccccctccactgtgccgtgtgtagttaatatctgccctttg
ggatgggacaaagaggaagacatggacttgcttcaggctccagagtcacttggacatatc
caactggaaaatcagagtgtttatgtctggagccctctagctggagagtgttcagtgtcc
tgtggtagaggtaagactcagatacagtatgtttgtgtggcttttgacaccaaagaaaaa
acccaagaagaaaactgtcatccagtggcaaagccagagagcaggatggaagactgcaat
ctcagtccctgcccgccaaggtggcattacaaaatgggctcatgcagtgtaagctgtgga
ggaggtgtgatgcagaaggtcctctactgtgcaagggaaaccagggagaaggaggaagag
attgtggcagacacccagtgtgatggtttgcctcgtccagaggagcaggaaccgtgtaac
ttggagccatgccccccaagatggaaggtaaccccgggtggcccctgttcctccagctgt
gggcttggcttatcagttcagctggtcacctgtgtgcagattcaccaaggcaaagagatt
ttgctggagcagcatttatgtcctgtatcagagaagccccttaccaccattccctgtgtc
gtccgaatgtgctcttacgaatggagcttcagcgaatggacagagtgttcaacttcgtgt
gggaatggtgttcagacacggcatgatttctgcctcaaccggctaactcataagcacgtg
aaccccatcttctgcaggcgcttccccaaggccattgtgctgcgtggctgctatgcaggg
ccctgtcctgagcaggaggtgggcaccaggttgcatggagcagaactgcaggcagtgaca
ccagccacgcatctgatgacagttgcaaatgctaaaggggcaagatacaaagtcctggat
cttcctccttctgctgtgccagctgtccctcaggaacaggcaaaggagaccagtgaaggt
gtctgtggaaagctctttcttaataccagtggggtcatcaacatgacaggtgtagagagc
agtgactgcactgttgctattgggcgtcctttaggagaggagatcacaatcaatgttctg
gagagctccctcaactgcagtgcaggtgaggttgtgctgttttctggacgaatgatgtgg
cggacaggctgcaggaagctggttttgtctctgataaattccagaacaaatacattgatt
gtgaaacagcgtgttttgctgccaggaaatggggttgttcttcagtacaacagcagaaat
gcaactaaaaaatattaccaagaatgtgacaagcagctgtttggaccccgtggtgaaata
gtgaatcctatgcaatcacctggtcaaagacaagaagtagtgtgtcgtaccttcatcaat
gtggctcctcagcatcgtgtagctatccgaggcctgtatgttgaccagagccacgagagc
aaccaaacacactttaattatatcctgatccgtgatgtaagcaccatgaagacaatggtg
tttcgtgggaaacaacaattcttctggcaatcaactgggagccaagctgaaattgaattt
catgaaaatgttaaagatcaccaaagcagtttctgggctgaatatcatgctgctgaaccc
aaataa

DBGET integrated database retrieval system