KEGG   Natrialba magadii: Nmag_0612Help
Entry
Nmag_0612         CDS       T01176                                 

Definition
(GenBank) putative oxidoreductase (aldo-keto reductase family protein)
  KO
K06222  2,5-diketo-D-gluconate reductase B [EC:1.1.1.346]
Organism
nmg  Natrialba magadii
Brite
KEGG Orthology (KO) [BR:nmg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Nmag_0612
Enzymes [BR:nmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.346  2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming)
     Nmag_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-ProteinID: ADD04198
UniProt: D3SYT7
Position
606611..607417
Genome map
AA seq 268 aa AA seqDB search
MSSQSPQLPQPGLGTSGHEGESCTDAVVTALESGYRHIDTAQMYDNEEAVGRALEQADID
REDVFLATKVHPSNLAAEDVLESTRESLDRLGVDTVDLLYVHWPMGEYDAEETLPAFDEA
VEVGLTRHVGVSNFTPDLLEEAVSMLDAPVVAHQIELHPELQQDELVSLGREHDIQTVAY
CPIAKADVAEIGVLQEIADDHDATPIQVALAWHYDRESVVPIPKGTGEHIHENYEAREIE
LTDDDRDRIDDLDAGERLVDPDDAAWNR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcacagtcaccacaactcccgcaaccgggtctcggcacctccggccacgaaggc
gagtcgtgtaccgacgccgtcgtcaccgcactcgagtccggctaccgtcacatcgacacc
gcacagatgtacgacaacgaggaagccgtcggtcgcgcgctcgaacaggccgacatcgac
cgcgaggacgtcttcctcgcgacgaaggttcacccgtcgaatctggctgcggaggacgta
ctcgagtccacccgtgaaagtctcgaccgactcggcgtcgacacggtcgacctgctctac
gtccactggccgatgggggagtacgacgccgaggagacgctgccggcgttcgacgaggcc
gtcgaggtgggactgacgcgccacgttggcgtgagtaacttcacgccggaccttctcgag
gaggccgtctccatgctcgatgctccggtcgtggctcaccagatcgaactccatcccgaa
ctgcagcaggacgaactcgtttcgctcggccgcgagcacgacattcagacggtcgcgtac
tgcccgatcgccaaggctgatgtcgcagagatcggcgttctgcaagagatcgccgacgac
catgacgcgacgccgattcaggtcgcgctggcgtggcactacgaccgcgagagtgtcgtt
ccgattccgaaggggacgggcgagcacatccacgagaactacgaggcgcgcgagatcgag
ttgacggacgacgaccgcgaccggatcgacgacctcgatgcgggtgagcgactggtcgat
ccggacgacgcggcctggaatcggtag

DBGET integrated database retrieval system