KEGG   Natrialba magadii: Nmag_0614Help
Entry
Nmag_0614         CDS       T01176                                 

Gene name
dpd
Definition
(GenBank) putative dihydropyrimidine dehydrogenase
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dus His_biosynth DUF1633 NMO PcrB G3P_antiterm IGPS Radical_SAM QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADD04200
UniProt: D3SYT9
Position
608551..609291
Genome map
AA seq 246 aa AA seqDB search
MFSPPLALASLSGESDADWARSGADYAGCAFLGGIAIDDRSRAAARELVARDRTEFLPDD
PLTFVDRQLQALEPESTPIQPAVNVRSATREPIRDVAQVCHEHDALLEINAHCRQDELCA
VGCGETLLADTDRLAGYVETAASTSAAVGVKVRAEVPGVELPVLAGVLESAGASFVHVDA
MDTESVIAEIADATDLFVIANNGVRDEETVREYVEYGADAVSVGRPSDNPVVLERVHDAV
VAQLES
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttctccccaccgctcgccctcgccagtttgagcggcgaatccgacgccgactgggcc
cgttccggtgccgactacgccggctgtgctttcctcggcgggatcgccatcgacgaccga
tcgagagccgccgcgcgcgaactcgtcgcccgcgaccgaaccgagttcctccccgacgac
cccctcacgttcgtcgaccgccagcttcaggcactcgaacccgagtccaccccgatccag
ccggcggtcaacgtccgcagcgcgacccgggaaccgatccgcgacgtggctcaggtctgt
cacgagcatgacgcactgctcgaaatcaacgcccactgccgacaggacgaactgtgcgcc
gtcggctgcggtgagacgctcctcgcggacacggatcgcctggcgggctacgtcgaaacg
gcagccagcaccagcgcagccgtcggtgtgaaggtccgcgccgaagtccccggtgtcgag
ttgcctgtgttggcgggtgtactcgagtctgccggtgcgtcgttcgtccacgtcgacgcg
atggatacggagtcggtcatcgccgagattgcggacgccacggacctcttcgtaatcgcg
aacaacggcgtccgtgacgaggagacggttcgggagtacgtcgagtacggtgcggatgcg
gtgagtgtgggtcggccgagtgacaatcctgttgtactcgagcgggtccacgatgcggtg
gtggcgcagttggagtcgtga

DBGET integrated database retrieval system