KEGG   Natrialba magadii: Nmag_0641Help
Entry
Nmag_0641         CDS       T01176                                 

Definition
(GenBank) uncharacterized protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD04226
UniProt: D3SZ92
Position
635851..636567
Genome map
AA seq 238 aa AA seqDB search
MRWGLSNHSNYSTHRRLVRALILSQLTTYHPQPRSRSDVRRTQPHLTDPPSPTDRCPGFP
VLAPESQHCALWRRTVMGWPLTTGAIQSRTQLSKLIPTWYQLPVEATNEKAYTETLDNRR
WNWNERESKRHGYSHTGTRVTPAEALSRLRWRRFDPGVQRRVPLGVFGLRCARNRIPIPF
GRVGRDPTAASVSLSQRIDFSAHLQSRPASSICRMGCRDEALLVVAADSGGVRWIDQS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcgatggggattatctaaccactccaactactcaactcatcgacgactggtccgggcg
ttgatcctgtctcaactgaccacataccacccccagccgcgttcgcgcagcgacgttcga
cggacacagccacatcttactgatccaccctctcctacggatcggtgtcctggttttccg
gtactcgcccccgagagccagcattgtgcgctgtggagacgtactgtcatgggctggccg
ctcactactggagcaatccaatcgcgtacgcagttgtcaaaactgattccaacgtggtac
cagctaccggtcgaagccacgaacgagaaagcctataccgagacactagacaacagaagg
tggaactggaatgaacgagaatcgaaacgtcatggatattctcacacaggtacgagagtc
acgccggcggaagcgctgtcccgactgcgatggcgtcgtttcgatccgggggttcagagg
cgagtaccgctgggagtgtttggactgcgatgcgctcggaatcggatacccatcccgttc
ggccgcgttggacgggatccaacagcggcgtcggtgagtctctcgcagagaattgacttc
tccgcacaccttcagtctcgtccagcgtcgtcgatatgccggatgggatgtcgcgacgaa
gcgctgctggttgtggccgccgactcggggggagtgaggtggatcgaccagtcatga

DBGET integrated database retrieval system