KEGG   Natrialba magadii: Nmag_0644Help
Entry
Nmag_0644         CDS       T01176                                 

Definition
(GenBank) death-on-curing family protein
  KO
K07341  death on curing protein
Organism
nmg  Natrialba magadii
Brite
KEGG Orthology (KO) [BR:nmg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:nmg02048]
    Nmag_0644
Prokaryotic defense system [BR:nmg02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Doc-Phd
    Nmag_0644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fic
Motif
Other DBs
NCBI-ProteinID: ADD04229
UniProt: D3SZ95
Position
637792..638280
Genome map
AA seq 162 aa AA seqDB search
MADSFWYPSVGDVLAIHDDIVSEYSDTHAGVQNRGDVEFALNYIESGSFGTAPETIHEKA
FHLIRLLVANHPFVDANKRTALNTTVVFYFLNGYRFVYDNEIRTVLKQFGTDQATVDETE
TLEYLRSHTEEIDLAGEIEQWRDDLIRYGLDELTGDSSNPND
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggcagactcgttctggtatccgtcagtgggcgacgttctcgccatccacgacgatatc
gtatctgagtattctgatacgcacgctggcgtccagaatcgtggcgatgtcgagtttgcc
ctgaactacatcgagagtgggagtttcggaacggcacccgaaacgattcacgagaaagcg
tttcacctcattcggctattggtggcaaaccacccgttcgtcgacgcaaacaaacgtact
gcactcaatacgacggtcgtgttctactttctcaacgggtatcggttcgtgtacgataac
gaaatcaggacggtcctcaagcagttcggcacggatcaggcaaccgtcgacgaaacggaa
accctcgaataccttcgatctcacaccgaagaaatcgacctcgcaggtgagatcgaacag
tggcgcgacgatctcatccggtacggattggacgaactaaccggcgattcgtctaacccg
aacgattaa

DBGET integrated database retrieval system