KEGG   Natrialba magadii: Nmag_0648Help
Entry
Nmag_0648         CDS       T01176                                 

Definition
(GenBank) DUF2267 family protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2267
Motif
Other DBs
NCBI-ProteinID: ADD04233
UniProt: D3SZ99
Position
640788..641198
Genome map
AA seq 136 aa AA seqDB search
MQYDDFIGEVQHGAQLDSREAALSISRATLTTLSERIQPGEAENLGAQLPAELGRFLEDV
DDVERFEFEEFITRVSERSQVGEGDPADATFHAQIVMEVVTEAVDPGAIDDVRDQLPADE
GYADLFELAEQEESPR
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacgatgacttcatcggcgaggtccaacacggcgcacagctcgactcacgagag
gccgcactgagcatctcgcgggcgacgctgacgacactttcggagcgcattcagccgggc
gaggccgagaatctgggtgcccagcttccggcagagctcggccgattcctcgaggacgtc
gacgacgtcgaacgcttcgagttcgaggagttcatcacccgggtcagcgagcgctcgcaa
gtcggcgagggcgacccggccgacgccacgttccacgcccagattgtcatggaagtcgtg
actgaggccgtcgatccaggcgcaatcgacgacgttcgcgaccagttgccggccgacgag
gggtacgccgacctgttcgagctggccgaacaggaggagagtccgcgctga

DBGET integrated database retrieval system