KEGG   Natrialba magadii: Nmag_0649Help
Entry
Nmag_0649         CDS       T01176                                 

Definition
(GenBank) GNAT family acetyltransferase
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_4 Acetyltransf_7 Acetyltransf_3 Acetyltransf_10 HTH_24 Acetyltransf_9 HTH_20 HTH_42 UBA_4 Acetyltransf_CG DUF4821
Motif
Other DBs
NCBI-ProteinID: ADD04234
UniProt: D3SZA0
Position
complement(641472..642203)
Genome map
AA seq 243 aa AA seqDB search
MALRDTLEFGHADRKAIYEYVERHGTVSPAEVQDRLGIDPGGFRHHVAILKRDGQLEETD
SELHVTIDAGAEEEYAAGEVSFHIRPARQEDLAGIVGAIRQVAEEKTYIEGESVADEIDH
EQALLRHNELESRMFFVATVEDEVVGWVHLYAPELEKLGHTAELTVGVVEGYRGHGIGSH
LLARGLEWAGSNGYEKVYQSVPSSNEEAIAFLEAHDWETEAVREDHYKLNGHYVDEVMMA
IEL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcactacgagatacgctcgagttcggccacgccgaccgaaaagccatctacgagtac
gtcgagcgccacggcactgtctcacctgcggaagtccaggaccgactcgggatcgaccct
ggtggctttcgccaccacgtcgcaatcctgaaacgggacggccagcttgaggagaccgac
agcgagctccacgtcacgatcgacgccggcgccgaagaggagtacgccgccggtgaggtc
tcgttccacatccggccagccagacaggaagacctggccggcatcgtcggtgcgattcgg
caggttgcagaggagaaaacctacatcgaaggcgagagcgtcgccgacgaaatcgaccac
gagcaagccctgctcagacacaacgaactcgagtcccggatgttcttcgtcgcaaccgtc
gaagacgaggtcgtcggctgggtccacctctacgcaccggaactcgagaagttgggccac
acagccgaactcaccgtcggcgtcgtggaaggctaccgcgggcacggcatcggttcgcac
ctgctcgcacgtggactcgagtgggcaggttcgaacgggtacgagaaggtctaccagagt
gttccctcgagcaacgaggaggcgattgcgttcctcgaggcacacgactgggagacggag
gctgttcgagaggaccattacaagctcaacggtcactacgtggacgaggtcatgatggca
atcgaactgtag

DBGET integrated database retrieval system