KEGG   Natrialba magadii: Nmag_0651Help
Entry
Nmag_0651         CDS       T01176                                 

Definition
(GenBank) uncharacterized protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhnA_Zn_Ribbon HypA DUF5423
Motif
Other DBs
NCBI-ProteinID: ADD04236
UniProt: D3SZA2
Position
complement(644040..644720)
Genome map
AA seq 226 aa AA seqDB search
MTPPVPPDGERKLDPKRRRRSPRQEFPQAQARNGRSQYSAPGVTSSQIPRDTHTGRRDHN
DEATHNDTGARRTRLTDESEDTDDTAGADDPAADAETDTDTGDEENETNTEHSDCTATDD
RAAARRAVHTHRVRRNAQRHRNQDPHTPRSTRNGDSSTEQTESEAEESAFVTVPRQQLVQ
LQNALVGVAHAANISIGAPCTHCERSYMLVSDGLLSCPHCGYRRSL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacacccccagtaccaccggacggcgagcgtaagctcgatccaaaaaggcggcgacgc
agtcctcgtcaagagttcccacaggcccaggccagaaacggacgttcccagtattccgcg
cctggtgttacgtccagtcagatccctcgagacacgcacactgggcgccgcgatcacaac
gacgaggcgacacacaatgacaccggtgcacgtcgtaccagactcactgacgagagcgag
gataccgatgatactgctggtgctgatgatcctgctgctgacgctgagaccgataccgat
accggtgacgaggaaaacgaaaccaacaccgaacacagcgactgcacagcaacagacgac
cgagccgctgcacgacgtgcagttcacacacatcgcgttcgcaggaacgcacagcgacat
cgcaatcaggacccccacacgccacggtctactcgtaacggggactcgagtaccgagcaa
acggaatcagaagccgaggagtcggcgttcgtcacggtccccagacagcaactcgttcag
ttgcagaacgcgctcgtgggggttgcacacgcggcgaatatctcgatcggggcgccgtgt
acgcactgtgagcgcagttatatgctggtgtcggatgggctgttgtcctgtccacactgt
ggctaccggcgttcactctga

DBGET integrated database retrieval system