KEGG   Natrialba magadii: Nmag_0653Help
Entry
Nmag_0653         CDS       T01176                                 

Gene name
guaB1
Definition
(GenBank) inosine-5'-monophosphate dehydrogenase
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
nmg  Natrialba magadii
Pathway
nmg00230  Purine metabolism
nmg01100  Metabolic pathways
nmg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Nmag_0653 (guaB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nmg04147]
    Nmag_0653 (guaB1)
Enzymes [BR:nmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     Nmag_0653 (guaB1)
Exosome [BR:nmg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Nmag_0653 (guaB1)
  Exosomal proteins of breast cancer cells
   Nmag_0653 (guaB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMPDH CBS NMO FMN_dh His_biosynth ThiG Glu_synthase DHO_dh Dus G3P_antiterm
Motif
Other DBs
NCBI-ProteinID: ADD04238
UniProt: D3SZA4
Position
647100..648602
Genome map
AA seq 500 aa AA seqDB search
MANDVPEHEPYSSKLTVPEALTFDDVLLRPKESRVEPDDADLTSNVSTTVELSVPILSAA
MDTVTESDMAIAMARHGGLGVLHRNMNIDEMVEEIDRVKSADELVIPFDSVVTADPEMSV
REVDDLMARQGVGGAPVVNTNGEVLGIISSTDIRPHLEVNEDDPVTEAMTDEVITAPEDI
NARDAFDLMYEHKIERIPVVDDENLLVGLVTMQGILQRREYKEAVRDEDGRLRCGVAVSP
FEQERAEAADEAGADILFIDTAHAHNLNVIDGAREIKESVDADVVVGNIGTREAAEELVE
FADGLKVGIGPGSICTTRVVSGSGMPQITAVAQVADVASEHDVPVIADGGIRYSGDAIKA
VAAGADAVMLGSYFAGTDEAPGRVVTMNGKKYKQYRGMGSVGAMKSGDSDRYLKEEPDEE
EDYVPEGVEAATPYKGSLQSELHQLAGGMQSGMGYVGAATIPAFKERSEFVRVSSAGQAE
SHAHDVVITDEAPNYSPDGD
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgacgttcctgagcacgagccgtactcttcgaaactcaccgtaccagaggcg
cttacgttcgacgacgtcctccttcgacccaaggagagccgcgtcgaaccggacgacgcg
gacctcacatcgaacgtatcgaccaccgtcgagctctcagttccaattctctctgccgca
atggacaccgtcaccgagagcgacatggcaatcgcgatggcccgacacggcggcctcggc
gtcctccatcgcaacatgaacatcgacgagatggtcgaagaaatcgatcgcgtcaagagc
gcagacgaactcgtcattcccttcgactccgtcgtcaccgcagatcccgaaatgtccgtc
cgcgaagtcgacgacctgatggcccgacagggcgtcggcggcgcacccgtcgtcaacacc
aacggcgaggtgctcgggatcatctcgagtacagacatccggccacatctcgaggtcaac
gaggacgacccggtgacagaagcgatgaccgacgaggtcatcacggctccagaagatatc
aacgcccgcgatgcgttcgatctgatgtacgagcacaagatcgaacgtattccggtcgtc
gacgacgagaacctcctcgttggcctggtgacgatgcaggggattctccagcgccgcgag
tacaaggaagccgttcgcgacgaggacggtcgcctgcgctgtggcgtcgcagtcagccca
ttcgagcaggaacgcgccgaagccgcagacgaagccggcgcggacattctctttatcgac
accgcacacgcgcacaacctgaacgtcatcgacggagcgcgtgagatcaaagagagcgtc
gacgccgatgtcgtggtaggcaacatcggcactcgtgaggcggccgaagagctcgtcgag
ttcgcagacggtctcaaagtcggcattggacctggatcgatctgtacgacccgcgtcgtc
tcggggtcgggtatgccacagatcacggccgtcgcgcaggtcgcagacgtcgcgagcgag
cacgacgtccccgtcatcgcagacggtggcattcggtactccggcgacgcgatcaaagcg
gtcgccgccggtgcggacgccgttatgctcggttcgtacttcgccggcaccgacgaggca
cccggccgcgtcgtcacgatgaacggcaagaagtacaagcagtatcgcggcatgggcagc
gtcggcgcgatgaaatctggggacagcgaccggtacctcaaagaagaacccgacgaggag
gaagactacgtcccagagggtgtcgaggcagcgacgccgtacaagggctcgctccagtcc
gaactccaccagctcgccggcggaatgcagtccgggatgggctacgtcggtgcagcgacg
attccggcgttcaaagagcgttcggagttcgttcgggtctcctcagccggacaggctgag
agtcacgcccacgacgtggttatcacggacgaagcgccgaactactcgccagacggcgac
tga

DBGET integrated database retrieval system