KEGG   Natrialba magadii: Nmag_0654Help
Entry
Nmag_0654         CDS       T01176                                 

Definition
(GenBank) cupin 2 barrel domain protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 AraC_binding TF_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: ADD04239
UniProt: D3SZA5
Position
complement(648654..649139)
Genome map
AA seq 161 aa AA seqDB search
MEKVSIEEVDNEQNPMGVHSVRRPISAALGFSDFAMNYFELEPGESFSGGYHTHHDQEEV
FYVQAGTAVFDTEDGPVTVEADEVIRFGPGEFQQGYNPEDADERVVGFAFGAPGAQHEWD
QIESLVYCRVCETEQGHGLALTDEGQFELTCTDCENAFVLE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagtctcgatcgaagaggtcgacaacgaacagaatccgatgggtgtccactcg
gttcgccgaccgatctcggcggcgctcggcttctctgacttcgcgatgaactacttcgaa
ctcgagcctggcgagtcgttttcgggcggctaccacacccaccacgatcaggaagaagtc
ttctacgtccaggcgggtacggcggtgtttgataccgaggacgggccggtgacggtcgag
gcggacgaggtaatccgctttggaccgggggagttccagcagggatacaaccccgaagac
gccgacgaacgggtcgtcggcttcgcgttcggtgcaccaggcgcacagcacgagtgggac
cagatcgagtcgctggtctactgtcgcgtctgcgaaaccgaacaggggcacggactggcg
ctcactgacgagggtcagttcgaactcacctgtacggactgtgagaacgcgttcgtactc
gagtaa

DBGET integrated database retrieval system