KEGG   Natrialba magadii: Nmag_0665Help
Entry
Nmag_0665         CDS       T01176                                 

Definition
(GenBank) uncharacterized protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltranf_PUA
Motif
Other DBs
NCBI-ProteinID: ADD04250
UniProt: D3SZB6
Position
complement(660435..660962)
Genome map
AA seq 175 aa AA seqDB search
MSDDSSADLRKNDGQQFGRLPETDADRTVEGRVSRAAVVDYFEDRFAIPPGTFDDYTFWE
KGAGKIWLYSGEADSPLEIEAIGMTCLRTRQEHWKPTTDFVQRFGAHASECVIDLDREAA
RRFAAGEDQELEWDGDWGYLIAAHTVVGEREPLGIGLYVHGELRSMVPKGRQREL
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgactcgagtgccgacctgcgcaaaaacgacggccagcagttcgggcgtctc
ccagaaaccgacgccgaccgaaccgtcgagggccgtgtcagccgcgctgccgtcgtcgac
tacttcgaggatcgctttgccatcccgcccgggaccttcgacgactacaccttctgggag
aaaggcgcgggcaagatctggctctacagcggcgaggccgactccccgctggaaatcgag
gccatcggcatgacctgtctgcgaacccgccaggagcactggaagccaacaacggacttc
gtccagcgctttggcgcacacgccagcgagtgcgtgatcgacctcgaccgcgaggccgcc
cgccggttcgccgccggcgaggaccaggaactcgagtgggacggcgattggggatacttg
atcgcggctcacaccgttgtgggcgagcgcgaaccgctcggaattgggctgtacgtccac
ggcgagttgcgttcgatggtgccgaagggacgacagcgagagttgtag

DBGET integrated database retrieval system